Details for Kale Locus Bo5g145240

Position : C5 ( 5`- 44992632 .. 44996818 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145240

Protein [Map View]
MLCLFLTCPGGSYDGGGGGGTTSPEEEATMGVDLIAGGKRKRPKGQLLSPTMSISSLPSRFLVRRTQSKFNAVILKRLFM
SKVNKAPLSLSRLVEFMTGKEDKIAVLVGTITDDLRVHEIPAIKVTALRFTERARASIEKAGGECLTFDQLALRAPLGQN
TVLLRGPKNSREAVKHFGPAPGVPHSHSKPYVRSKGRKFEKARGKRKSRGFKICPLRCPVLIAGVVRGWVHVSFSSCALI
LGFDGLSCSSFELCLRVELCVASGARCTGRRWYDVAAGSGVRRANCGSDMAWIDDSVDFNRFILLSKWKRMVLSVVSHYR
DDFNFGYDRKRKSSEVSMLVLELKKEAVSNYGLTVLNSFKLCWLMVWSGLYMLVPYCEAIILAYLTSTAPTIPRSFSKLL
PDSLLNNDSIGYSTIHQVPEIMKSHLNLLTLPMKHRMFRQLFFLKDLRTHVKLLSIFGPAPGVPHSHSKPHVPSKGRKLE
KARGK*

DNA
ATGCTGTGTCTGTTTTTAACATGTCCTGGGGGAAGCTACGACGGCGGCGGCGGCGGCGGCACCACATCCCCGGAGGAGGA
GGCTACAATGGGTGTTGATTTGATCGCAGGAGGTAAGAGGAAGAGACCAAAAGGACAGCTCCTAAGTCCGACGATGTCTA
TCTCAAGCTTACCGTCAAGGTTTCTGGTAAGGAGAACACAGAGCAAGTTCAATGCAGTGATCTTGAAGAGGCTTTTCATG
AGCAAAGTCAACAAAGCTCCTCTTTCTCTATCCAGGCTCGTCGAGTTCATGACTGGCAAGGAAGATAAGATTGCTGTCTT
GGTTGGAACTATAACCGATGATTTGAGGGTACACGAGATCCCAGCTATCAAAGTTACTGCCTTGAGGTTCACTGAGAGAG
CCAGAGCTAGCATTGAGAAAGCTGGTGGTGAATGCTTAACCTTTGACCAGCTTGCTCTCAGAGCTCCTTTGGGACAGAAC
ACTGTTCTGCTTAGAGGACCTAAGAACTCACGTGAGGCTGTGAAGCATTTTGGCCCTGCTCCTGGTGTGCCACACAGCCA
CTCCAAGCCGTATGTTCGGTCCAAGGGAAGGAAGTTCGAGAAGGCCAGAGGAAAGAGGAAGAGCCGTGGTTTCAAGATCT
GTCCTCTCCGGTGTCCGGTTCTCATCGCCGGCGTCGTGAGAGGGTGGGTTCATGTGTCTTTTAGTTCTTGTGCTCTGATT
TTAGGTTTTGATGGATTGTCATGTTCAAGTTTCGAGCTTTGTCTCAGAGTTGAACTGTGTGTTGCGTCTGGCGCAAGATG
TACAGGTCGCAGATGGTACGATGTAGCTGCTGGGAGTGGTGTTCGAAGAGCCAATTGTGGTTCAGACATGGCTTGGATTG
ATGACTCGGTGGACTTCAATCGCTTCATACTATTATCGAAATGGAAGCGAATGGTTCTTAGTGTTGTTTCTCACTACAGA
GATGATTTCAACTTCGGTTATGACCGTAAACGCAAGTCTTCAGAGGTTTCTATGCTGGTGTTGGAGCTCAAGAAAGAAGC
AGTCTCAAACTATGGCCTGACAGTGCTGAATAGTTTTAAGCTATGCTGGCTCATGGTTTGGAGTGGTCTTTATATGCTTG
TTCCTTATTGTGAAGCTATCATCTTAGCTTACTTAACATCAACAGCACCAACCATTCCACGAAGCTTCTCAAAACTGCTA
CCTGATTCTCTGTTGAACAATGACTCAATCGGTTACTCCACCATTCACCAAGTCCCTGAGATAATGAAATCTCACCTCAA
TTTGCTTACTCTTCCCATGAAACACCGGATGTTTAGACAGTTGTTCTTCTTAAAGGACCTAAGAACTCACGTGAAGCTGT
TAAGCATTTTTGGCCCTGCTCCTGGTGTGCCACACAGTCACTCCAAGCCTCATGTTCCGTCCAAGGGAAGGAAACTCGAG
AAGGCTAGAGGAAAATAG