Details for Kale Locus Bo5g145180

Position : C5 ( 5`- 44970432 .. 44973130 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145180

Protein [Map View]
MAQNSTLFTAISLLVFSIFSHCQALTLEALCESTPHPPVCKSVLPVGPPGSVSGFASIVIIKSLEASKHLLASFDQHHPT
TGPLDDCQLLAGLTVDQLTRVNVIKETVLGTSEVNDLLTLLSAAITNYETCLGSFHDATGESSENFVKDHHDILTRVSDG
IKLISVSLALSKEAWPIASDASVTKPPPRILTEDEKKSSSPEVSYVKVTKPVSGRGFIARDITFRNTAGPHNRQAVALRV
DSDQSAFFRCSMEGYQDTLYAHSLRQFYRECEIYGTIDFIFGNGAAVLQNCKIYTRVPLQLQKVTITAQGRKSPNQNTGF
VIMNSYVLATQPTYLGRPWKLYSRTVYMNTYMSQLVQPRGWLEWFGNFALDTLWYGEYNNIGPGWRASGRVKWPGYHIMD
KRTAMSFTVGSFIDGRRWLPATGVTFTAGLAN*

DNA
ATGGCTCAAAATAGTACTCTGTTCACGGCCATCTCTTTGCTTGTTTTCTCTATCTTTTCTCATTGTCAAGCCCTAACTTT
GGAAGCTCTTTGTGAATCCACTCCTCACCCGCCCGTCTGTAAATCCGTTCTACCAGTCGGGCCACCCGGTTCAGTTTCAG
GATTTGCCAGTATTGTCATCATAAAGTCTCTAGAAGCTTCTAAACACCTTCTGGCCTCCTTCGACCAGCATCATCCCACA
ACAGGACCCCTTGATGATTGCCAATTACTAGCCGGTCTGACCGTTGACCAGCTCACACGTGTGAACGTCATCAAGGAGAC
CGTTCTTGGAACCTCCGAGGTCAACGATCTCCTCACGTTGCTTAGCGCCGCTATTACCAACTACGAGACGTGCCTAGGCT
CGTTTCATGATGCTACCGGAGAGTCATCCGAGAATTTTGTTAAGGACCACCATGATATCCTCACACGTGTTTCGGACGGA
ATAAAGCTGATTAGCGTTTCTCTTGCCTTGTCCAAGGAGGCTTGGCCGATAGCATCTGATGCTTCAGTGACAAAGCCACC
ACCGAGGATTCTTACGGAGGATGAGAAAAAGTCTTCGTCGCCAGAAGTTTCGTATGTGAAGGTGACGAAACCTGTTTCTG
GAAGAGGATTCATAGCAAGGGACATAACTTTCAGAAACACGGCCGGGCCACATAACCGTCAAGCTGTTGCATTAAGGGTC
GATTCCGACCAATCCGCCTTCTTCCGATGTAGCATGGAAGGTTACCAAGACACTCTCTACGCCCATTCCCTCCGTCAATT
CTACAGAGAATGTGAAATTTATGGTACAATCGATTTCATATTTGGAAACGGCGCCGCGGTACTACAGAACTGTAAAATAT
ATACCAGGGTTCCATTACAGCTCCAGAAGGTAACTATAACCGCACAAGGGAGAAAAAGCCCTAACCAGAACACAGGGTTT
GTGATCATGAACAGTTACGTGTTAGCCACACAGCCTACTTATCTTGGCCGGCCGTGGAAACTTTACTCAAGAACGGTTTA
CATGAACACTTATATGAGCCAGCTGGTCCAGCCCAGAGGCTGGCTTGAGTGGTTTGGTAACTTTGCTTTGGATACTTTGT
GGTATGGCGAATATAATAATATTGGGCCGGGTTGGCGGGCATCTGGTCGGGTTAAATGGCCCGGTTATCATATTATGGAC
AAACGGACTGCGATGTCCTTCACCGTTGGATCGTTCATTGACGGTCGGAGGTGGCTTCCGGCAACAGGTGTCACGTTCAC
GGCTGGCCTAGCTAATTAA