Details for Kale Locus Bo5g145160

Position : C5 ( 5`- 44963427 .. 44966082 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145160

Protein [Map View]
MGKRNNLKRSVRSKDKGSDESDEDYVISDEDESEGDDLNEYAYGEDSFDGCAVEEDEVEVEVEEEEVVLRCVEWPKVKTG
PRGNRKITGCRSRKVEQVVVVSDKEEDEDLDDAEEGDEREGVKEIGLGKRRRVFYEVEDEDGDYPEEEDVSCGKEEMALE
EQENASEKEDDGDYDEDEDGDEEFTGDEEDVSLDEEEEEEALKVCKRNKRKQRSRGGRKRRNVASGRKRRGKNTEEGVDD
DDGDFVDDCLPARKRARSLRPRRRCTLQSDSDIASSGESDYEYTISEEEREQVREASSLLRTRVKHVSSTRKATVHKDLP
KPRKSPVKKSEKKVEIVMKNVCGICLSEEDMRRLKGALDCCSHYFCFTCIMEWSKVESRCPLCKQRFRTISKPARSTHGV
DLREVVIRVPERDQVYQPTEEELRSYLDPYENIICSECHQGEDDGLMLLCDLCDSSAHTYCVGLGREVPEGNWYCEGCRP
GSASSQTTSEPQRVSGFYSRPSPLVVSGQYQDPSSLVSPRTPFSSGDYLFSSRNGDVQGSSPSGLGGATTLSRRRTLHRH
IQNIINGDRLVNMGSRSGGTSMIANSSDGFLATQIGHGREIEPPQPTGMSLYTISEERLHSNNPLISTHGPELLSPKLDH
FGSEGVRHFSSNTFRGDAPIDLGLRHGLAQGDPVFGNQQHLRSYMPNTMFLTGGERLQQRVKAHLQNLSRQINLGQATFE
EISTCSIHTILAACGLEHKSSEVHFVPPSVTCPHDDMRPGSSSGNNNSSSSSLMNGCCSSCFDSFVEDVVKMILDTRQPH
WLRLGLH*

DNA
ATGGGGAAGAGAAACAATTTAAAGAGAAGCGTTAGATCTAAGGATAAGGGCTCAGATGAATCAGATGAGGATTATGTGAT
ATCAGACGAGGATGAATCTGAAGGTGATGATCTGAATGAGTATGCCTACGGTGAAGATTCTTTTGATGGTTGTGCTGTGG
AGGAGGATGAGGTGGAGGTGGAGGTGGAGGAGGAGGAGGTTGTGCTGAGGTGCGTTGAGTGGCCGAAAGTGAAGACCGGT
CCACGTGGCAATCGGAAGATCACGGGATGCAGGTCGAGAAAGGTGGAGCAGGTTGTTGTTGTTTCTGATAAGGAAGAAGA
TGAGGATCTTGATGATGCTGAGGAGGGAGATGAGAGGGAGGGTGTGAAAGAGATTGGTTTAGGTAAGAGGAGGAGAGTTT
TCTATGAGGTGGAAGATGAAGATGGAGACTATCCAGAAGAGGAAGATGTGAGCTGTGGAAAGGAAGAGATGGCGTTGGAG
GAGCAGGAGAATGCGTCAGAAAAAGAAGATGATGGAGATTATGATGAGGATGAGGATGGTGACGAAGAGTTTACTGGAGA
TGAAGAAGATGTCTCACTAGACGAGGAAGAGGAGGAGGAAGCACTCAAGGTTTGTAAGAGAAACAAGCGGAAGCAGAGAT
CTAGAGGAGGGCGTAAAAGAAGAAATGTTGCAAGTGGAAGGAAGAGACGAGGGAAGAACACTGAGGAAGGAGTTGATGAT
GATGATGGTGATTTTGTAGATGACTGCCTACCTGCAAGAAAGAGGGCGAGATCATTAAGGCCAAGGCGTCGGTGTACTTT
ACAATCAGATTCAGACATTGCCTCCTCTGGAGAGTCTGATTACGAGTACACAATCTCAGAGGAGGAAAGAGAGCAGGTAA
GAGAAGCCAGTAGTCTGTTGAGAACTAGAGTGAAGCATGTGTCATCTACACGAAAAGCTACGGTCCATAAAGATCTGCCT
AAGCCTCGTAAGTCACCTGTGAAGAAAAGTGAAAAGAAGGTAGAGATAGTGATGAAAAACGTGTGTGGGATTTGTCTCTC
TGAGGAAGACATGAGGAGATTAAAGGGAGCACTTGACTGTTGTAGTCATTACTTTTGCTTCACTTGCATAATGGAGTGGT
CAAAAGTGGAATCTCGATGCCCTCTATGCAAGCAGCGGTTCAGAACAATTAGTAAACCCGCGAGATCTACACATGGTGTT
GATTTGAGAGAAGTCGTGATACGTGTACCCGAGCGTGATCAGGTCTATCAACCCACTGAGGAAGAGCTGAGGAGTTATCT
CGATCCATACGAAAATATAATATGCTCGGAGTGTCACCAAGGTGAAGACGATGGGCTTATGCTGCTTTGTGATCTTTGTG
ATTCATCTGCACATACGTACTGTGTTGGACTCGGGAGGGAAGTACCTGAAGGAAACTGGTACTGTGAAGGTTGTAGACCT
GGATCAGCTAGCTCCCAAACCACGTCCGAGCCACAAAGGGTGAGTGGCTTTTACAGTAGACCATCACCTCTTGTTGTTTC
AGGGCAATATCAAGATCCGTCCTCGCTAGTCTCCCCGCGTACACCGTTTTCCAGTGGAGATTACCTTTTCTCTTCGAGGA
ATGGTGATGTTCAAGGCTCTTCTCCATCCGGGTTAGGGGGAGCAACCACGTTGTCGAGAAGAAGGACGCTTCATAGACAC
ATACAAAATATTATCAACGGTGATAGGCTTGTAAATATGGGGAGTAGAAGTGGTGGAACATCGATGATTGCTAACTCGAG
TGATGGTTTCTTGGCTACACAAATTGGTCATGGCAGAGAAATAGAACCGCCTCAACCTACAGGGATGTCTTTGTATACAA
TCTCTGAGGAAAGACTCCACAGTAACAATCCATTGATTTCTACCCATGGACCTGAGCTTTTATCTCCCAAGTTAGATCAT
TTTGGAAGCGAAGGAGTCAGACATTTCTCTAGTAATACATTTCGTGGCGATGCACCCATCGATTTAGGATTGCGTCATGG
ACTCGCTCAGGGTGATCCCGTGTTTGGTAATCAGCAACATCTACGCAGCTACATGCCAAACACAATGTTTTTGACGGGAG
GCGAACGACTGCAACAAAGAGTTAAAGCTCATCTCCAGAACTTGTCTCGTCAAATCAACTTAGGACAAGCCACGTTTGAG
GAGATTTCCACGTGCTCAATACACACGATACTGGCAGCTTGTGGACTGGAACACAAGAGCAGTGAAGTCCACTTTGTCCC
GCCGTCAGTGACGTGTCCTCACGATGATATGAGACCTGGGAGCAGCAGTGGTAACAACAACAGCAGCAGCAGCAGCCTGA
TGAATGGGTGTTGCTCTTCTTGTTTTGATTCGTTTGTAGAAGATGTAGTTAAGATGATTCTGGACACAAGACAACCCCAT
TGGTTGAGGTTAGGGCTCCACTAA