Details for Kale Locus Bo5g145140

Position : C5 ( 5`- 44954585 .. 44957903 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145140

Protein [Map View]
LISGIIDYKKNKAKEIKILSDTRIEASLKPPFLDAGGVSNRRRRAPLSLSCSRPRLSCVFSDLFGVLVTAKAFVDRSLRR
RLAVESQSGWSFIYGPGFTGSDSSWGAPHSTSSVVFFTNCKRRASSLPLLTIVDSQIYEFLPLAWVSRVCSYGYGLLKSD
PPPYSPFDTSGLSLQLRFSHRENLSVRRPPPHRFSSYPPNWRMVSAFLPSLDSTRLSAGRRAHSAAYLLHRRCHSTVVTL
AELGQNNLLVGLISPSAFNFSPVSQLNNQWGILVFLAIFLKFFDRFIKIFTETELLLHDYLSLSKSLSFVHLPVDSSGSS
PSPSASSLRSAFPPIFEWRCFSISIAVLLSCVAVRSGPEDTTDFVLTIFRGADWMSTSRYTVTISQGFGNVVNFVLTHPS
VALDSLSYYLRAFAIFYVILEMTMQIMRESLLSAPQIPWWNVFGSQPLAPASLAGDSDSFPAGYAGETEHGGDKQSNSAS
HLAFSLGDVKNSRDVTKPHGSVFSMKPPLLGTWIFSATAYGSQSRVMLPLNMETEDGTIYVNSKQYHGIIRRRQSRAKAA
SVLHHNKLSSRGRKPYMHHSRHLHALRRPRGSGGRFLNTKSQKADDTKQTQSQPQKSNSQNSEVIHLEGQIMNLSHGLNV
SVSEVTSMNYFLSSSVHLLGGMVIAQQVVCSSSNG*

DNA
CTTATAAGTGGGATCATTGATTATAAGAAGAATAAGGCTAAAGAGATAAAAATCCTCTCAGACACGAGAATCGAGGCGTC
TTTGAAACCACCATTTCTTGACGCCGGTGGGGTCTCAAACCGCCGGCGTCGAGCTCCTCTCTCTCTCTCTTGCTCCCGTC
CTCGTCTCTCTTGCGTTTTCTCAGATCTTTTCGGCGTTTTAGTCACCGCCAAAGCTTTCGTCGACAGATCTCTCCGGAGA
AGGCTTGCCGTCGAGAGTCAAAGCGGTTGGTCTTTCATTTACGGACCGGGCTTCACCGGATCCGATTCTTCTTGGGGGGC
TCCCCATTCCACTTCATCCGTCGTGTTTTTCACCAACTGCAAACGCCGTGCTTCATCATTGCCGCTCCTCACCATCGTTG
ACTCTCAGATCTACGAGTTTCTACCTCTAGCTTGGGTGAGCAGAGTTTGTTCCTACGGATATGGACTTCTCAAGTCAGAT
CCGCCGCCGTACTCGCCGTTTGATACCTCTGGTCTCTCGTTGCAGCTACGCTTTTCTCACCGAGAAAACCTTAGCGTCAG
ACGACCTCCTCCACATCGCTTTAGCTCGTATCCACCGAACTGGAGGATGGTATCAGCTTTTCTCCCGTCACTGGACTCAA
CCCGTCTTTCCGCCGGCCGTCGTGCTCATTCCGCTGCGTATCTTCTTCACCGGCGATGCCACTCTACTGTTGTCACTCTT
GCGGAGTTGGGCCAAAACAATTTGCTAGTGGGCTTGATAAGCCCATCTGCGTTTAACTTCAGCCCAGTTTCACAGCTCAA
CAATCAGTGGGGGATCTTGGTCTTTTTGGCTATTTTTCTGAAATTTTTTGATAGATTCATCAAGATTTTTACAGAAACTG
AATTGCTTTTACATGATTATCTCTCTTTGTCGAAGAGTCTATCTTTTGTTCATTTACCGGTGGATTCATCGGGCTCATCA
CCATCACCATCTGCCTCCTCTTTGAGGAGTGCTTTCCCTCCAATCTTTGAATGGAGGTGTTTTTCCATATCTATAGCCGT
TTTGTTATCTTGTGTAGCGGTTCGTTCGGGGCCTGAAGATACAACGGATTTCGTCTTGACAATATTCCGAGGTGCGGATT
GGATGTCAACGTCACGATATACGGTGACTATTTCTCAAGGTTTCGGCAATGTCGTAAACTTTGTATTGACGCATCCGAGC
GTTGCTCTGGATTCGCTGTCCTACTATCTTAGAGCGTTTGCTATCTTTTATGTTATTTTGGAGATGACTATGCAAATTAT
GAGAGAAAGTCTTCTCTCTGCTCCACAGATTCCTTGGTGGAATGTTTTTGGATCTCAGCCCTTGGCTCCAGCGAGTCTTG
CCGGAGATTCTGACTCCTTCCCGGCTGGGTATGCCGGAGAGACAGAACATGGTGGGGATAAACAGAGCAACTCTGCATCT
CACTTAGCTTTCTCACTTGGTGATGTAAAGAATTCAAGAGATGTGACAAAGCCTCATGGATCTGTTTTCTCAATGAAACC
ACCTTTGCTTGGAACTTGGATTTTCTCAGCCACAGCTTATGGATCTCAGAGCAGAGTAATGCTCCCTCTAAACATGGAAA
CAGAAGATGGAACAATCTACGTCAACTCAAAGCAATACCATGGTATCATAAGGCGACGCCAGTCCCGTGCAAAAGCTGCT
TCTGTTCTTCATCACAACAAACTGAGTAGCAGAGGTCGTAAGCCTTATATGCATCATTCACGTCACCTCCATGCATTGCG
CCGTCCTAGAGGATCCGGTGGGAGATTCTTGAACACCAAAAGTCAGAAAGCTGATGACACTAAGCAGACTCAGTCTCAGC
CTCAGAAAAGTAACTCTCAGAACTCTGAAGTTATTCATCTTGAAGGTCAGATCATGAACTTATCACACGGACTCAATGTC
TCAGTATCAGAAGTTACAAGCATGAACTACTTTCTGAGTTCTTCGGTCCATCTTCTTGGTGGCATGGTAATTGCCCAGCA
AGTGGTTTGCAGCAGCAGCAATGGATAA