Details for Kale Locus Bo5g145130

Position : C5 ( 5`- 44947331 .. 44948921 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145130

Protein [Map View]
MATRNRTLLFRKYRNSLRSVRAPMTESKSGVGPVIEMASTSLLHPKRSYTPVSTEDPANSSKGAVTVGLPPDWVDVSEEI
SVNIQRARTKMAELGKAHAKALMPSFGDGKEDQHQIESLTQEVTLLLRKSEKQLQRLSKGGPSEDSSVRKNVQRSLATDL
QQLSMELRKKQSTYLKRLRLQKEDGGDLEMNLNGSSSRAEDDDFDDILFSEHQMSKIKKSEEISVEREKEIQQVVESVNE
LAQIMKDLSALVIDQGTIVDRIDYNIQNVASTVEDGLKQLQKAERTQRSGGMVKCASVLVILCFIMLVLLILKEIIF*

DNA
ATGGCGACTCGGAACCGCACGCTCTTGTTCAGGAAATACAGAAACTCTCTGAGGAGCGTCCGTGCTCCGATGACGGAATC
GAAATCCGGCGTAGGTCCGGTGATCGAGATGGCGAGCACGTCTCTATTGCATCCCAAACGCTCCTACACTCCAGTCAGTA
CCGAAGATCCAGCGAACTCAAGTAAAGGAGCAGTGACGGTGGGGTTACCACCGGATTGGGTTGATGTCTCTGAGGAGATT
TCGGTGAACATTCAGCGTGCGAGGACCAAAATGGCTGAGCTTGGGAAGGCTCACGCGAAGGCCTTGATGCCTTCGTTTGG
GGATGGTAAAGAGGATCAGCATCAGATCGAGTCTTTGACGCAAGAGGTTACTTTGTTATTGAGGAAATCGGAGAAGCAGC
TTCAGAGGCTTTCTAAAGGCGGACCTTCTGAGGATTCAAGTGTTAGGAAGAACGTGCAGCGGTCTCTTGCTACTGATCTC
CAACAACTTTCGATGGAGCTTCGCAAGAAACAGTCTACTTATTTGAAACGCTTGAGGCTACAAAAAGAGGATGGAGGGGA
TTTAGAGATGAATCTAAACGGAAGCAGTTCTAGAGCAGAAGATGATGACTTCGATGATATATTATTTAGTGAGCATCAGA
TGAGCAAGATCAAGAAGAGCGAGGAGATATCTGTAGAGAGGGAGAAAGAGATTCAGCAGGTTGTTGAATCAGTAAATGAG
CTGGCTCAGATAATGAAGGATCTCTCTGCGCTTGTGATAGACCAGGGTACGATAGTTGATCGGATTGACTATAACATCCA
GAACGTTGCTAGTACAGTTGAAGATGGTCTCAAACAGCTGCAAAAGGCAGAACGTACACAGAGAAGTGGAGGTATGGTTA
AGTGTGCGTCTGTTCTTGTCATACTCTGTTTCATCATGTTAGTTCTCTTAATCCTCAAGGAGATTATCTTCTGA