Details for Kale Locus Bo5g145110

Position : C5 ( 5`- 44940343 .. 44941843 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145110

Protein [Map View]
MEDFQSPRIRSYKSYEGDRNLQLVDPADLKPVRGIYVVRESKRNRSPMTSDLWRKISYKDLPVRPRRASSHSTSLKGWWN
DPEMKRKRRVAKYKIYSVEGKMKTSWRKSYKWIKTTTPIHLVSPKFLKTERKQFWFTTLLLVVLLISAGIPKSEATCTKY
LGEAILAYPCKESYCEAKCAEFYHESCRGECEDHDHHHGVHLTNDHDDHCHCYGRY*

DNA
ATGGAGGATTTCCAGTCTCCTAGAATACGATCTTACAAATCGTATGAAGGAGATCGGAACCTCCAATTGGTTGATCCTGC
CGATTTAAAACCGGTGAGAGGGATTTACGTTGTTAGGGAATCAAAACGCAACCGATCTCCCATGACATCGGATCTATGGC
GCAAGATCTCTTACAAAGACCTGCCCGTTAGACCGAGAAGAGCTTCTTCTCATTCAACATCGTTAAAAGGATGGTGGAAC
GATCCGGAGATGAAGAGAAAGAGACGAGTGGCGAAGTACAAGATTTATTCAGTCGAAGGAAAGATGAAGACATCTTGGAG
AAAGAGCTACAAGTGGATTAAGACTACAACCCCCATTCATTTAGTATCACCCAAGTTTCTGAAAACAGAAAGAAAGCAAT
TTTGGTTCACCACTCTCCTGCTCGTTGTCTTGTTGATTTCAGCTGGAATCCCGAAGAGCGAGGCGACGTGTACGAAGTAC
TTAGGCGAAGCCATATTGGCGTATCCATGCAAGGAAAGCTACTGTGAAGCAAAATGCGCTGAGTTTTACCACGAGTCATG
CAGAGGAGAGTGTGAGGATCATGATCACCACCACGGAGTGCATTTAACAAATGACCATGACGATCATTGCCACTGCTACG
GTCGTTATTAA