Details for Kale Locus Bo5g145090

Position : C5 ( 5`- 44927500 .. 44930153 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145090

Protein [Map View]
MIETEAVERKRSRGGFLTLFDWSGKSRKKLLSSTTTTTSGPSEAPKQEKQNAQTSSKSSPSIEETGKSLTYSPRRDSSCS
TSTVTSDDRQGSRAPSVVARLMGLESLPVANSLEQPRSNPDFDPFFLSSSRKASTWDAYESLGYVNLRSHYDGISWDHLD
SRTNNNESHRLPINRFQTETLPPKSAKPISVTHNRLLSPIRSPGFVQSRNPAQVMEAASRMIEPSPRIAAAKARFPSSEA
SSSSIPMRIRDLREKLEASQKKQTPQISNGTRNNKCLRGKNETSSLKTQETNKLLGKTSKAKPPSVSAAHTKANTTHKQE
NSTSSSSSNKVQKEKVQTKNRIVKKDPKESSANSTGKALAKQNNQKQNQPAVTSVSKQKSSKVMNKVVNKVLVETGTSSK
KPGPKKNPPRNKKPANGVQEPGVISEKLIKRGEKLKKCNISVESDRKKDMDVISFTFSSPIKGISSTKRTTDQERESALS
LSAINGDSLNILLEQKLRELTSKIESSSSGLTQEGESSGSISKDWVNGTISLPSDDLDKVSSENESVSDCTSFYNNRKFQ
AEEQEVNSFGTEAEDLQISNSHNEIEETELSESVALAEAEEEGHHDWELEYITEIISSNQLMVKEISLGMATDILPWSLF
DELESKRDPRGNLERKTLFEFVNEWLTVRCEKTFMGSCRGLFLFGRKEVLAEEMKREIERLKKIREMMMVDELVDSEMSS
FEGRWLDYKREAYEEGSEIEEEILSDLVDELVNDLLLCF*

DNA
ATGATAGAAACGGAGGCTGTTGAGAGGAAACGATCCAGAGGAGGCTTTTTAACTCTCTTTGATTGGTCTGGTAAATCCCG
GAAGAAGCTTCTCTCCTCTACCACAACCACCACCTCTGGACCCTCCGAAGCACCAAAGCAAGAGAAACAAAATGCTCAAA
CCTCCTCAAAGTCATCCCCCTCTATTGAGGAGACAGGAAAGAGTTTGACTTACAGTCCTAGAAGGGACTCTAGTTGCTCA
ACATCCACTGTCACTAGCGATGATAGACAAGGGTCCAGAGCCCCGAGTGTGGTCGCCAGGCTCATGGGTTTGGAGTCTCT
ACCTGTGGCAAACTCCCTGGAACAACCTCGGTCTAATCCTGATTTTGATCCCTTCTTCCTCAGTTCCTCACGCAAGGCAA
GCACATGGGATGCGTACGAGAGTTTGGGCTATGTGAATCTCCGCAGTCACTATGATGGCATTTCTTGGGATCATTTGGAT
TCAAGAACGAATAACAACGAGTCTCACCGGTTACCTATTAACCGCTTTCAAACCGAGACGTTGCCTCCAAAGTCGGCTAA
ACCAATCTCCGTCACTCACAACAGGCTCTTGTCGCCTATCCGGAGTCCTGGTTTTGTTCAGTCTAGGAACCCTGCTCAAG
TTATGGAAGCAGCTTCGAGAATGATCGAGCCAAGTCCTCGGATAGCTGCTGCTAAAGCACGTTTTCCATCGTCTGAGGCT
TCCTCTTCATCGATTCCAATGAGGATCAGAGATTTGAGAGAGAAGCTAGAAGCTTCACAGAAAAAACAAACTCCACAAAT
CTCTAATGGTACCCGCAACAATAAGTGTTTAAGAGGGAAGAATGAAACATCATCACTCAAGACACAGGAGACGAATAAGT
TATTGGGTAAAACCAGTAAAGCGAAGCCGCCTTCTGTATCTGCTGCACACACAAAGGCTAATACTACTCACAAGCAAGAG
AACTCAACGTCCTCAAGTAGCAGCAACAAAGTTCAAAAGGAGAAGGTACAAACCAAGAACCGCATAGTTAAAAAAGATCC
AAAAGAATCTTCTGCTAACAGCACTGGGAAAGCTCTGGCTAAGCAGAATAACCAGAAACAGAACCAACCCGCTGTGACGT
CTGTTTCAAAACAGAAAAGCAGCAAAGTGATGAACAAAGTTGTAAACAAGGTGTTGGTGGAAACCGGAACTTCATCTAAG
AAGCCTGGTCCTAAGAAGAATCCTCCTCGCAACAAAAAACCGGCAAATGGGGTGCAAGAGCCTGGAGTGATCAGTGAGAA
ACTGATCAAAAGGGGTGAAAAGTTGAAGAAATGTAACATCAGTGTTGAAAGTGATAGAAAGAAGGACATGGATGTGATCT
CGTTCACTTTCTCATCCCCCATCAAGGGCATATCATCTACTAAAAGGACCACCGATCAAGAAAGAGAATCTGCACTTAGT
TTGAGTGCAATCAACGGTGATTCTCTAAATATATTATTGGAACAGAAGCTTAGGGAGCTAACCTCTAAGATTGAGTCATC
TAGCAGTGGCCTAACACAAGAGGGAGAGTCTTCAGGCTCCATTTCAAAGGATTGGGTGAATGGGACCATATCTTTGCCGT
CTGATGATCTTGATAAAGTTTCATCAGAGAATGAATCTGTCTCTGACTGTACTTCTTTCTACAATAACCGAAAGTTTCAG
GCAGAAGAGCAGGAAGTAAACAGCTTTGGAACAGAAGCTGAGGATCTCCAAATCTCAAATTCACACAATGAGATTGAAGA
AACAGAACTCTCAGAATCAGTAGCTTTAGCAGAAGCTGAAGAAGAAGGCCATCATGACTGGGAGCTTGAGTACATAACCG
AGATCATATCCTCTAACCAACTGATGGTGAAAGAAATCTCCTTGGGCATGGCTACTGATATATTACCTTGGAGCCTCTTC
GACGAACTCGAATCCAAGAGAGATCCACGTGGAAACCTGGAGAGAAAAACGCTGTTTGAGTTTGTGAACGAGTGGTTAAC
AGTTAGATGCGAGAAGACGTTCATGGGAAGCTGCAGAGGATTGTTTTTGTTTGGAAGGAAAGAGGTTTTAGCTGAGGAAA
TGAAGAGGGAGATTGAGAGGTTGAAGAAGATAAGAGAGATGATGATGGTGGATGAGCTCGTTGACAGTGAGATGAGTAGC
TTTGAAGGGAGATGGCTTGATTACAAGAGAGAGGCGTATGAAGAAGGGAGTGAGATTGAAGAAGAGATTTTGTCTGATTT
AGTTGATGAGTTAGTTAATGATCTTCTCTTGTGTTTCTAA