Details for Kale Locus Bo5g145080

Position : C5 ( 5`- 44893849 .. 44895766 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145080

Protein [Map View]
MASSNTTPGVDNTFRKKFDTEEYRERARKREEKEADRSKSQPKGPPVQRAPLKHRDYHVDLESRLGKTQVVTPVAPLSQQ
AGYFCRVCDCVVKDSANYLDHINGKKHQRALGMSMRVERSSLEQVQERFEVLKKRKTPGTFSEQDLDERIRKQQEEEEEH
KRLRREKKKEKKKGKVIEEEPEMNPEVAELMGFGGFGSSKKS*

DNA
ATGGCTTCTAGCAACACCACTCCAGGGGTTGATAACACGTTCAGGAAGAAGTTCGATACGGAAGAGTATCGGGAACGTGC
ACGTAAACGCGAAGAGAAGGAGGCGGATCGGTCTAAATCTCAGCCTAAAGGTCCTCCTGTGCAAAGAGCTCCTTTGAAGC
ATAGAGATTATCATGTGGACCTAGAGTCTCGCCTGGGCAAGACCCAGGTTGTTACACCGGTAGCGCCTCTAAGTCAGCAG
GCTGGTTATTTCTGTCGCGTTTGTGACTGTGTTGTTAAAGATTCAGCTAACTACTTGGATCACATTAATGGGAAAAAACA
TCAAAGAGCGTTGGGAATGTCTATGCGGGTGGAGAGATCGTCTCTTGAACAAGTACAGGAGCGGTTCGAGGTGTTAAAGA
AACGGAAAACGCCAGGAACTTTCTCAGAACAAGACCTGGACGAACGGATCCGGAAACAGCAAGAAGAAGAGGAGGAACAT
AAACGGCTGCGGCGGGAGAAAAAGAAAGAGAAGAAGAAAGGGAAGGTGATAGAGGAGGAGCCTGAGATGAACCCTGAGGT
TGCAGAGCTGATGGGATTTGGGGGCTTTGGATCTTCCAAAAAATCATGA