Details for Kale Locus Bo5g145070

Position : C5 ( 5`- 44891158 .. 44893291 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145070

Protein [Map View]
MANNLPDEFHGATPIWFVGLGGEDTLVQEGLYPPLNLTYTPTQEHFNKIESKFQEERQKQLYSTENTKTLTTHDTPTTTE
KLKAMNFEISKIIIGEWTHKSVYPDDLKAKFYFAKRRLMWEILDEDSKLKRKIEMQWSDVLSFRASYPPQNETGTLEVEL
GKCPTFFLEANPQRGKHTQWEQLDQDFTPGQSASKYRRHTLHISPGDLKMNLEKLVSAVSFWSKLAKVNFPTLPHSLYFD
NGNSNNNDNSNLCPYGNSRTPGINGNHHYPQGLGHVPVENVNFNMATEFCPNNQMNPIFQDDHQDETMSQLPGMQVTHPS
SQHINMGRYIISESHFNNPMIPDDRHTSNTGELRGPYLQVILAQEEVIQNMKCIRQFQTNGECYCNQCFNNINGSLPPDS
*

DNA
ATGGCTAATAATCTCCCTGATGAATTCCATGGAGCAACACCGATCTGGTTTGTAGGTTTGGGAGGCGAAGACACCCTGGT
CCAAGAGGGTCTATATCCACCTTTAAACTTGACTTACACACCAACTCAGGAACATTTCAACAAAATTGAATCCAAATTTC
AAGAAGAAAGGCAAAAGCAACTTTATTCCACAGAGAACACAAAGACCTTAACGACTCATGACACTCCTACAACTACTGAA
AAACTAAAGGCTATGAATTTCGAAATCTCCAAGATCATAATTGGTGAATGGACTCACAAGTCGGTCTACCCTGATGATCT
TAAGGCCAAATTCTACTTTGCAAAGAGGAGACTTATGTGGGAGATTCTCGATGAAGATTCAAAACTTAAGAGAAAGATTG
AGATGCAATGGTCTGATGTCTTGTCTTTTAGAGCTAGTTATCCTCCACAAAATGAAACAGGAACACTAGAAGTCGAGTTG
GGAAAGTGTCCAACGTTCTTCTTGGAGGCTAATCCACAGCGAGGAAAGCACACTCAATGGGAACAGTTGGATCAAGACTT
TACCCCAGGTCAATCTGCTTCTAAATACAGGAGACATACACTTCATATTTCCCCTGGAGATCTGAAGATGAACTTGGAGA
AGCTTGTGTCCGCCGTTAGCTTCTGGTCAAAACTCGCCAAAGTCAATTTCCCAACTCTACCACATTCTCTTTACTTCGAT
AATGGAAACAGTAACAACAATGATAATAGCAACTTGTGTCCCTACGGAAACAGCAGAACACCTGGCATCAACGGCAATCA
TCACTATCCTCAAGGACTTGGTCATGTGCCAGTGGAGAACGTAAACTTCAACATGGCAACTGAGTTCTGCCCGAATAATC
AAATGAACCCAATTTTTCAAGACGATCACCAGGATGAAACTATGAGTCAATTACCTGGGATGCAAGTTACACATCCATCA
TCTCAGCATATCAACATGGGAAGGTACATTATTAGCGAGTCACATTTTAACAATCCGATGATCCCAGACGATCGCCACAC
GAGTAACACAGGTGAGTTACGTGGACCGTATCTACAAGTCATCTTAGCTCAAGAAGAAGTGATACAGAACATGAAATGCA
TACGTCAGTTTCAGACCAACGGAGAATGTTATTGTAATCAATGCTTCAACAACATCAATGGTTCACTGCCTCCTGATTCG
TAG