Details for Kale Locus Bo5g145060

Position : C5 ( 5`- 44884958 .. 44885563 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145060

Protein [Map View]
MSGTNPSKSPELEGTETVPFRRRLVTAQRGQRVFAPKLLEALRRSRRSSEGPASHISRRWGDTTAQKVYSLKLYDALQRS
RRSTTVRDTADKVLAATARGTTRWSRAILVSRLGRSLRRHKKTKPASAVRGGGGGRRKLSAVGNRVRVLGGLVPGCRRTA
LPELLDETADYIAALEMQVRAMTALSKIMSEFQPSDKLGSA*

DNA
ATGTCTGGAACGAATCCATCGAAGTCGCCGGAGTTAGAAGGAACTGAAACCGTTCCTTTTCGCCGGAGATTGGTAACGGC
TCAAAGAGGTCAAAGAGTTTTCGCTCCAAAGCTACTGGAGGCTCTTCGTAGATCAAGAAGAAGTTCAGAGGGCCCGGCGA
GCCATATTAGTCGGAGGTGGGGAGATACGACGGCGCAGAAGGTTTATTCTTTGAAGCTCTACGACGCTCTCCAGCGATCA
CGGCGGAGCACAACGGTCCGAGACACGGCCGACAAAGTGCTAGCGGCTACAGCTCGTGGTACGACTCGGTGGAGCCGAGC
CATATTGGTCAGTCGACTCGGGAGGAGTCTGCGGCGACACAAGAAGACAAAGCCGGCGTCGGCGGTCAGGGGAGGTGGAG
GAGGGAGGAGGAAGTTGTCGGCGGTGGGAAATCGGGTCCGAGTGTTGGGTGGTTTGGTGCCAGGTTGCCGGAGAACGGCG
TTGCCGGAGCTTTTGGACGAGACGGCTGATTACATAGCGGCGTTGGAAATGCAAGTCCGAGCCATGACGGCTCTATCGAA
AATTATGTCTGAGTTTCAGCCGTCCGATAAACTTGGCTCTGCCTAA