Details for Kale Locus Bo5g145050

Position : C5 ( 5`- 44877813 .. 44879252 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145050

Protein [Map View]
MSFSDKTIVDPLLKDLDEKKESFRRNVVSLASELKQVRGRLVSQEQSFLKETQTRKEAEKKAKNMEMEMCKLHKRLEERN
SQLHASASAAEKFIKDLEEFRSQLDATNQTAGASADSAESTKIQCSVLKQQLDDKTRSLREHEHRVTQLGHQLDDLQRGL
SLRECSERQLREELRRIEREVTESIAKAGIDRNDCVLKKFLEDVSPVNFERMNRLVEVNDVEVKKLKDEIRLMSGHWKHQ
TKELESQLEKQRRTDQDLKKKILKLEFCLQETRSQTRKLQRKEERRDMEIKEIRDLMSGKQQGNEESWGKQKFWDNSGFK
IVVSMSMLMLVIVSKR*

DNA
ATGTCTTTTTCCGACAAAACCATTGTGGATCCGCTTCTGAAAGATTTGGACGAGAAGAAAGAGAGTTTCCGGAGGAACGT
CGTCTCTTTGGCGTCTGAGCTGAAGCAAGTGAGGGGCCGTTTGGTTTCTCAAGAACAATCTTTCCTTAAAGAAACCCAAA
CTAGAAAAGAAGCAGAGAAAAAAGCAAAGAACATGGAAATGGAGATGTGTAAATTGCATAAGAGATTAGAAGAAAGGAAC
TCTCAGCTTCATGCTTCTGCATCTGCTGCTGAAAAGTTTATTAAAGACTTGGAGGAATTTAGATCACAGCTGGATGCAAC
TAATCAAACCGCAGGAGCAAGTGCTGACTCCGCTGAATCTACAAAGATCCAATGCTCAGTGCTTAAACAACAACTTGACG
ACAAAACACGTTCTCTTAGAGAACACGAGCACCGTGTGACTCAGCTCGGGCACCAGCTTGATGATCTACAGAGAGGCTTG
AGTTTGAGAGAGTGCTCAGAGAGGCAGCTAAGGGAGGAGCTTAGGAGAATCGAGCGCGAGGTTACAGAGTCTATTGCAAA
GGCTGGGATAGACAGGAATGATTGCGTGCTGAAGAAGTTTCTAGAAGATGTCTCTCCTGTGAATTTTGAGAGGATGAATA
GATTAGTTGAAGTGAATGACGTGGAGGTCAAGAAACTGAAAGATGAAATTAGGTTGATGTCAGGTCATTGGAAGCATCAG
ACTAAGGAACTTGAATCTCAGTTGGAGAAACAGAGAAGAACTGATCAAGATTTGAAGAAGAAGATACTTAAGCTAGAGTT
CTGTCTTCAAGAAACTAGAAGCCAGACCAGAAAGCTGCAGAGGAAAGAGGAAAGAAGGGACATGGAGATTAAAGAGATAA
GAGATCTGATGTCAGGGAAACAACAAGGTAATGAAGAATCTTGGGGGAAACAGAAGTTCTGGGACAATTCAGGATTCAAG
ATCGTTGTATCAATGTCTATGTTGATGTTAGTGATAGTCTCCAAGAGATGA