Details for Kale Locus Bo5g145020

Position : C5 ( 5`- 44858588 .. 44858842 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g145020

Protein [Map View]
MGGNMSHSLFSFFKTRRSQRVEVDASWDDVVYTRKAMASDEDKRYWVAEPGIDRKASAFIAKFHATRVSASQRQSLSPYQ
SEKA*

DNA
ATGGGAGGAAACATGTCACACAGTCTCTTCAGCTTCTTTAAAACACGAAGATCTCAAAGAGTGGAAGTAGACGCCTCTTG
GGATGACGTCGTTTATACTCGCAAAGCAATGGCTAGTGATGAAGACAAACGTTACTGGGTGGCTGAGCCAGGTATTGATC
GCAAAGCGTCTGCTTTTATTGCCAAGTTTCATGCCACTCGTGTCTCTGCGTCCCAGCGCCAATCTCTCTCTCCTTACCAA
TCCGAGAAGGCATGA