Details for Kale Locus Bo5g144980

Position : C5 ( 5`- 44832294 .. 44834416 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g144980

Protein [Map View]
MVFSPFHLIISFLSSLSVKLTSSTTTTLLNKNLNKFCELEPCPLLFLFLNLLIMASDSQTATATTSEKPVENKVNEEAKL
MEKEIVLEETADVVKDKPVSDSSLTVTKEENISQTRAADVKEVAAVVKEEESTQKGADENGEKKVAEQVEVKEPILVKEG
VEEVKVEAGDAEKGKDENGEEKIAEEVELKEPTLVKESVEEVKVEAGDAEKGKDENGEEKIAGEVEVKEPALVKESVEEV
KVEAGDAEKGKDEDGEEKVAEEVELKEPILVKEGVDEEVKLEALDAEKAEEKGTVECVAEEGNKDKEESKVVAVSESAGV
KQVDDVQLVREVPEETVEDKIKDVEVLEVKPKPEEPTPETTEQAKVELVGKLEDTIVVETKDSKDEQTSMINQDSDTAPQ
KETEGDASSPADVTEKAITEEKHVVEEPSKDEQENVSEAKDVATKVATEEENIKKDTEDVKSEETLKETEGNKQEESVTE
KVAEAVETAPPVVKEIEEPEVTTKDEVVVKQKSSNSLMSKVKKSLVKAKKALTGKSPSSKTISTQEAKETSKPSD*

DNA
ATGGTTTTTTCTCCTTTCCACCTAATCATTTCCTTTTTAAGTTCTCTCTCAGTCAAACTAACTTCTTCAACGACAACAAC
TCTGCTAAATAAAAATCTCAACAAGTTTTGTGAACTTGAACCCTGTCCATTACTTTTTTTGTTCTTGAATCTTCTTATCA
TGGCTTCTGATTCTCAGACCGCAACTGCAACTACATCTGAAAAGCCAGTGGAGAACAAGGTGAACGAGGAGGCTAAGTTG
ATGGAGAAAGAGATTGTTTTGGAGGAAACTGCTGATGTTGTGAAGGATAAACCGGTTTCAGATTCAAGCCTGACTGTTAC
TAAGGAGGAGAACATCAGTCAAACTCGTGCTGCAGACGTAAAGGAGGTTGCAGCAGTTGTGAAAGAAGAGGAATCTACAC
AGAAGGGGGCAGATGAAAATGGTGAGAAGAAGGTAGCTGAACAAGTGGAAGTTAAAGAACCAATTCTTGTGAAAGAGGGT
GTTGAAGAAGTTAAGGTTGAAGCTGGTGATGCAGAGAAAGGAAAAGATGAAAATGGTGAGGAGAAGATAGCTGAAGAAGT
GGAGCTTAAGGAACCAACCCTTGTGAAAGAGAGTGTTGAAGAAGTTAAGGTTGAAGCTGGTGATGCAGAGAAAGGAAAAG
ATGAAAATGGTGAGGAGAAGATAGCTGGAGAAGTGGAAGTTAAAGAACCAGCCCTTGTGAAAGAGAGTGTTGAAGAAGTT
AAGGTTGAAGCTGGTGATGCAGAGAAAGGAAAAGATGAAGATGGTGAGGAGAAGGTAGCTGAAGAAGTAGAGCTTAAGGA
ACCAATACTTGTGAAAGAGGGTGTTGATGAAGAAGTTAAGCTTGAAGCTCTTGATGCGGAGAAAGCAGAAGAGAAGGGAA
CCGTTGAATGTGTAGCTGAAGAAGGCAACAAAGATAAGGAGGAGAGCAAGGTGGTTGCTGTTTCTGAATCAGCCGGAGTC
AAACAAGTTGATGATGTTCAACTTGTTAGAGAAGTACCTGAAGAGACTGTAGAAGACAAGATCAAAGATGTTGAGGTTCT
TGAAGTCAAGCCAAAGCCAGAGGAACCCACACCTGAAACAACAGAACAAGCTAAGGTTGAGCTTGTGGGAAAGCTGGAGG
ATACCATTGTTGTTGAGACCAAAGACTCCAAGGATGAACAGACTTCTATGATAAACCAAGATTCAGACACTGCCCCCCAA
AAGGAGACAGAAGGAGACGCTTCTTCTCCTGCTGACGTCACTGAGAAAGCCATCACCGAAGAGAAGCATGTAGTGGAAGA
ACCATCAAAGGATGAGCAAGAGAACGTAAGTGAAGCAAAAGATGTCGCCACTAAAGTAGCCACAGAAGAAGAAAACATCA
AGAAGGACACTGAAGATGTCAAGAGTGAAGAGACTTTGAAAGAAACTGAAGGAAACAAACAAGAGGAATCAGTCACAGAG
AAAGTAGCAGAGGCTGTAGAAACAGCACCACCTGTTGTTAAAGAGATCGAAGAGCCAGAAGTCACAACCAAAGATGAAGT
TGTTGTTAAGCAAAAAAGTTCAAACAGCCTCATGTCAAAGGTGAAGAAGTCTCTTGTTAAGGCAAAAAAAGCACTCACTG
GTAAATCTCCAAGCTCTAAGACTATCTCAACTCAAGAAGCCAAAGAGACATCAAAGCCAAGTGATTAA