Details for Kale Locus Bo5g144950

Position : C5 ( 5`- 44818297 .. 44819041 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g144950

Protein [Map View]
MAISMTHLFVTIMLLAAHTALAETNMLQDLCVADLKGSKVNGYPCKDPSQVTPEDFYYMGLANAADTSNTSMGSAVTAGN
VEKIPGLNMMGTSMSRIDYAPGGLNPPHLHPRASEAIFVLEGSLFVGFLTTSGKLISKHVNKGDVFAFPRALLHFQQNPN
KTPASVIAAFDSQNPGTQSVGPSLFGANPPIPDDLLAKAFSLGTNDIQNIKGKFQPKK*

DNA
ATGGCAATTTCCATGACTCATCTTTTTGTTACCATCATGCTTCTAGCCGCCCACACGGCCCTCGCAGAAACAAACATGCT
TCAAGATTTGTGTGTTGCTGATCTCAAGGGTTCAAAAGTCAACGGATACCCATGCAAAGACCCATCACAAGTAACACCAG
AGGACTTCTACTACATGGGCTTAGCCAATGCTGCAGACACCAGCAACACCTCAATGGGCTCAGCCGTCACAGCAGGCAAC
GTTGAGAAAATCCCTGGCCTCAACATGATGGGTACCTCCATGTCTCGTATCGACTACGCACCAGGCGGACTCAACCCGCC
GCATCTTCACCCCCGAGCTTCAGAGGCCATATTCGTCCTCGAAGGAAGCCTCTTCGTCGGCTTCTTGACCACCTCTGGAA
AACTCATCTCCAAACACGTCAACAAAGGAGACGTCTTTGCATTCCCCAGAGCTCTCCTCCATTTCCAGCAGAACCCTAAC
AAAACTCCTGCCTCGGTGATCGCTGCTTTCGATAGTCAGAACCCTGGGACGCAAAGTGTTGGACCGTCTCTGTTTGGCGC
TAACCCTCCCATTCCTGATGACTTGCTTGCCAAGGCGTTCTCGCTTGGAACAAATGATATTCAGAATATTAAGGGAAAGT
TCCAACCCAAGAAATGA