Details for Kale Locus Bo5g144930

Position : C5 ( 5`- 44813907 .. 44815869 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g144930

Protein [Map View]
MAADMLPVYLIILAFICTGGAIALALFHIYKHLLNYTEPIYQRYIVRIVFMVPVYALMSFLALVLPKSSIYFNSIREVYE
AWVIYNFLSLCLAWVGGPGSVVISLTGRSLKPSWHLMTCCFPPLPLDGRFIRRCKQGCLQFVILKPILVAVTLVLYAKGK
YKDGNFSPNQSYLYLTIIYTISYTVALYALVLFYVACKDLLKPFNPVPKFVIIKSVVFLTYWQGVLVFLFAKSGFIRDEE
EAALFQNFIICVEMLIAAAAHFYAFPYKEYEGANVGGAHSFSASLAHAVQLNDFYHDTVHQFAPAYHDYVLYNHNDGGEE
GTTKYRVRTFVPTGQEMDAVRKNKHMFGNKIEGVSPSSHSSSGTSTPKTSGATSDPARPETMKSSLLVDASDSASTMYDM
SLMDIDISSYPSKVPSANVSGGPR*

DNA
ATGGCGGCGGATATGCTACCTGTCTACCTCATTATATTGGCGTTTATATGCACCGGCGGAGCCATTGCTTTGGCCTTGTT
CCATATCTACAAGCACCTCTTGAACTACACGGAACCCATTTACCAGAGATATATAGTTCGCATTGTCTTCATGGTCCCTG
TCTACGCCTTGATGTCTTTCTTGGCTCTCGTCTTGCCCAAAAGCTCCATTTACTTCAACTCTATCCGAGAAGTTTACGAA
GCGTGGGTGATTTATAACTTTCTTTCCTTGTGCTTGGCATGGGTTGGAGGACCAGGTTCAGTTGTAATAAGCTTAACTGG
CCGCTCTTTGAAGCCTTCATGGCATCTCATGACTTGTTGCTTCCCACCTCTACCACTAGACGGGCGTTTTATTCGACGGT
GCAAGCAAGGTTGTCTGCAGTTTGTAATCCTGAAGCCAATCCTAGTTGCTGTCACACTTGTGCTCTACGCAAAAGGGAAG
TACAAGGATGGAAACTTTAGCCCTAATCAATCCTATCTCTATCTTACCATCATCTACACGATCTCATACACAGTAGCTTT
GTATGCGCTGGTTCTCTTTTACGTGGCTTGCAAAGATCTCCTAAAGCCATTCAATCCAGTCCCCAAGTTTGTGATTATTA
AGTCTGTTGTCTTTCTTACATATTGGCAGGGTGTTCTAGTTTTCCTTTTTGCTAAATCTGGATTTATAAGGGATGAAGAA
GAAGCAGCGCTGTTTCAAAACTTTATAATATGTGTGGAGATGCTTATTGCTGCAGCTGCACATTTCTATGCATTTCCTTA
CAAGGAATATGAAGGTGCCAATGTTGGAGGAGCACACAGTTTCTCAGCAAGTCTAGCACATGCTGTTCAGCTAAATGATT
TCTACCATGATACTGTTCACCAGTTTGCACCGGCGTATCACGATTATGTGCTGTACAACCACAATGATGGTGGTGAGGAA
GGGACGACGAAGTATCGAGTACGAACATTTGTGCCAACTGGTCAGGAAATGGATGCTGTCAGAAAGAACAAACACATGTT
TGGAAACAAGATAGAGGGTGTTTCACCCTCCAGTCACTCGTCCTCGGGAACAAGCACACCGAAAACTTCAGGTGCAACTT
CTGATCCTGCACGCCCCGAGACCATGAAATCTTCTTTGTTGGTAGACGCCTCGGACTCTGCTTCCACAATGTATGACATG
TCCCTCATGGACATTGATATATCGAGCTACCCAAGTAAAGTACCTTCTGCAAATGTAAGTGGAGGGCCTAGATAG