Details for Kale Locus Bo5g144920

Position : C5 ( 5`- 44809904 .. 44812001 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g144920

Protein [Map View]
MAVVVTSNGNAPAFEAKLTVYVFICVVIAAFGGLIFGYDIGISGGVTAMDDFLKEFFPAVWERKKHAHENNYCKYDNQFL
QLFTSSLYLAALVASFFASAVCSKLGRKPTMQFASIFFLIGVGLTAGAVNLIMLIFGRILLGFGVGFGNQAVPLFLSEIA
PAQLRGGLNIVFQLMVTIGILIANLVNYFTAKVHPYGWRIALGGAAIPAVFLLFGSLIICETPTSLIERNKNEEGKEALR
KIRGVEDINEEYESIVHACDIASQVKDPFRKLLKPASRPPFIIGMLLQLFQQFTGINAIMFYAPVLFQTVGFGSEAALLS
AVITGTINVLSTFVGIYLVDKTGRRFLLLQSSVHMLICQLIIGIILAKDLGTTGTLGKPQALVVVIFVCVYVMGFAWSWG
PLGWLIPSETFPLETRSAGFAVAVSCNMFFTFVIAQAFLSMLCGMRSGIFFFFSAWIVVMGLFAMFFIPETKGVAIDDMR
ESVWKPHWFWKRYMLDEDDVEKRN*

DNA
ATGGCTGTTGTTGTAACATCTAACGGGAACGCACCGGCTTTCGAAGCCAAGCTGACTGTCTATGTATTCATCTGCGTTGT
CATTGCTGCTTTCGGCGGTTTGATCTTCGGTTACGACATCGGAATTTCCGGTGGAGTGACGGCTATGGACGATTTCTTGA
AAGAGTTTTTCCCCGCGGTGTGGGAGAGGAAGAAGCACGCTCATGAGAACAATTACTGCAAGTATGATAACCAGTTCTTG
CAGCTATTCACATCGTCTCTTTACCTAGCCGCGCTCGTGGCCAGCTTCTTCGCTTCAGCCGTTTGTTCTAAACTCGGAAG
GAAGCCCACGATGCAGTTCGCTTCTATCTTCTTCTTGATCGGTGTGGGGCTAACCGCAGGAGCCGTTAACCTCATCATGT
TGATCTTTGGAAGAATCTTGCTTGGCTTTGGTGTTGGCTTTGGTAACCAGGCAGTGCCGCTTTTCTTGTCGGAGATTGCT
CCAGCACAGCTCAGGGGAGGTCTCAACATTGTGTTCCAACTCATGGTCACAATAGGAATCCTAATAGCCAACCTCGTCAA
TTACTTCACTGCCAAGGTACACCCTTACGGTTGGCGTATTGCTCTCGGTGGAGCCGCGATTCCCGCCGTTTTCCTCCTCT
TCGGTTCACTGATCATCTGCGAGACTCCCACGAGCCTCATCGAGCGCAACAAGAACGAAGAAGGCAAAGAGGCACTAAGG
AAGATCAGAGGAGTTGAAGATATAAATGAAGAGTATGAATCTATCGTCCATGCTTGTGACATTGCGAGTCAAGTCAAGGA
CCCTTTCAGGAAACTGTTGAAGCCAGCGAGTCGCCCACCGTTCATCATCGGAATGCTTCTCCAGCTTTTCCAGCAGTTTA
CAGGAATCAATGCTATTATGTTCTACGCGCCTGTTCTGTTCCAGACAGTTGGTTTTGGAAGCGAGGCAGCTCTTCTCTCT
GCGGTTATCACGGGAACCATCAACGTTCTGAGTACGTTCGTGGGGATCTACCTCGTCGACAAGACTGGTCGGAGATTCCT
TCTTCTACAATCTTCCGTTCACATGCTCATTTGCCAGTTGATCATTGGAATCATCCTAGCGAAAGACTTAGGCACGACAG
GGACACTCGGGAAGCCACAGGCACTAGTGGTTGTGATCTTTGTGTGCGTTTACGTGATGGGATTCGCGTGGTCATGGGGA
CCTTTAGGATGGCTGATTCCTAGCGAGACTTTCCCACTAGAGACACGAAGTGCAGGGTTCGCTGTTGCTGTCTCGTGCAA
CATGTTCTTCACGTTCGTGATCGCGCAGGCGTTCTTGTCGATGCTTTGCGGGATGAGATCGGGGATATTCTTCTTCTTCA
GTGCTTGGATCGTTGTCATGGGACTGTTTGCGATGTTCTTCATACCGGAGACGAAAGGAGTGGCGATTGATGATATGAGG
GAGAGTGTGTGGAAGCCGCATTGGTTCTGGAAAAGGTATATGCTTGATGAGGATGATGTGGAGAAGAGAAACTGA