Details for Kale Locus Bo5g144900

Position : C5 ( 5`- 44800388 .. 44800960 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g144900

Protein [Map View]
MTKRRICYIVSGIISILFITFMTILILSQTVFKPKHPVLQTLSTTVEGVSTHISPPLDVQINFTLTLQMLLKNPNLADFE
YKTVENLVYYRDILVGNLTLPSSTLPAKGSAILPCPLVLQIDKFVANLGDILQDILQRKIVIETKANMPGKITVLGIFKA
HLNTTSHCKLVLSVPSMEVVDQVCDLEAKL*

DNA
ATGACCAAACGACGTATTTGTTACATAGTTTCTGGAATCATTTCCATCCTTTTTATCACCTTTATGACCATTTTGATCCT
TTCCCAGACCGTGTTCAAACCAAAACATCCTGTATTACAAACCTTGTCTACGACTGTTGAAGGTGTATCCACACATATAT
CACCACCACTTGACGTCCAGATCAATTTCACACTTACACTCCAAATGCTGTTGAAGAATCCTAATCTTGCCGATTTCGAA
TACAAGACAGTAGAAAACTTGGTTTATTATAGGGATATTCTGGTGGGAAATCTCACTCTTCCTTCGAGCACACTTCCCGC
CAAAGGCTCAGCGATTTTGCCATGTCCTCTTGTTCTTCAGATCGATAAATTTGTTGCCAATTTAGGTGATATTTTGCAAG
ATATATTGCAAAGAAAAATTGTGATAGAAACAAAGGCAAATATGCCAGGGAAAATTACAGTGTTGGGAATCTTTAAGGCA
CACTTGAACACAACATCACATTGCAAACTCGTACTTAGCGTTCCTTCAATGGAAGTGGTGGATCAAGTGTGTGATCTTGA
AGCTAAACTATAA