Details for Kale Locus Bo5g144890

Position : C5 ( 5`- 44797519 .. 44798226 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g144890

Protein [Map View]
MVSEAVSKMESPPLIGPRISFSADLSDGGDFICISPVICKELEKGSVKVSDFEFLSENVTPQRMHTADELFSEGKLLPFW
QAKHSEKLKNVNLKTNEEEEQSRNGEVTMMKSRDQESNRVSWFIDEDPSPRPPKCTVLWKELLRLKKQRNSASSSVRTVS
SLSPSSSTSSSSSLEREEREKEGKRGKKGLERTRSASMRIRPMIHVPVCTPSKSSVPLPPLFPLSLKKNRAEKRT*

DNA
ATGGTCTCAGAGGCGGTTTCGAAGATGGAATCACCACCGTTGATTGGACCTCGCATCTCATTCTCAGCTGATTTATCCGA
CGGTGGAGATTTCATCTGCATCAGCCCTGTAATCTGCAAAGAGCTAGAGAAAGGGTCAGTGAAAGTCTCTGACTTTGAGT
TCTTGTCGGAGAATGTGACTCCACAGAGGATGCACACCGCCGACGAGCTCTTCTCCGAAGGAAAGTTGCTTCCTTTCTGG
CAAGCGAAGCACTCGGAGAAGCTTAAAAACGTTAACTTGAAGACCAACGAAGAAGAAGAACAGAGTCGTAACGGCGAAGT
GACGATGATGAAGAGTAGAGATCAGGAGAGTAACAGAGTGAGTTGGTTTATAGACGAAGACCCATCTCCTCGTCCTCCTA
AGTGCACTGTTCTCTGGAAAGAGCTTTTGAGGTTAAAGAAACAGAGGAACTCCGCTTCTTCTTCGGTGAGGACTGTGTCT
TCTTTGTCTCCGTCTTCTTCCACGTCATCATCGAGCTCGCTCGAGAGAGAGGAGAGAGAGAAAGAAGGGAAGAGAGGTAA
GAAAGGGTTAGAGAGGACGAGATCGGCGAGTATGAGGATAAGGCCGATGATTCATGTCCCTGTTTGCACTCCTTCTAAAT
CCTCTGTTCCGCTGCCTCCTCTGTTTCCGCTTTCTCTTAAGAAAAACAGAGCAGAGAAACGCACTTGA