Details for Kale Locus Bo5g144880

Position : C5 ( 5`- 44793700 .. 44796713 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g144880

Protein [Map View]
MSHLRLILLAVLSLVSSTLSQPSPPSAILIDCGASAATVITGRRWQPDGDFISAGTSKNVSDQVLDQVLSTVRSFPLTRR
RKFCYVVAVSRGWKYTIRTTYFYGGVNGKANPPPVFDQIVDGTLWGVVNTTADYADGLASYYEGVFLAQGKSLSVCVASN
SYTASDPFISALEVVRLDGTVYNSTEFGGFGLSLVARHAFGYSGPIIRFPDDEFDRFWEPYSLNSTVPNNRKLEVSGFWN
LPPSRIFNTDLRATQVQPLEFTWPPMPLKNSVYYIALYFAHDSDSLDGGGSRVFDVSVNGVTYYKELSVAPAGAVIFASR
WPLEGQTTLKLSPRSGSTLPPLINGGEMFELIARGGRTLVRDATALNAIKRSFENVPVDWSGDPCMPKNYSWTGVTCSEG
PRIRIVALNLTNMGLSGSLAPEVARLTALSSIWLGNNSLSGSIPDFGSLKLLESVHLEDNRFSGPFPSFFGGVPRLRELF
LQNNNLTGQVPSNLLQKPGLELRISGNPFLTQPPR*

DNA
ATGTCCCATCTCCGCCTCATCCTCCTCGCCGTTCTCTCCCTCGTCTCCTCCACTCTCTCTCAGCCCTCTCCTCCCTCCGC
GATCCTAATCGACTGCGGCGCCTCCGCCGCAACCGTAATCACCGGCCGGAGATGGCAACCGGACGGCGACTTCATATCCG
CCGGAACCTCCAAAAACGTCTCCGACCAAGTCCTCGACCAAGTCCTATCCACCGTCAGATCCTTCCCTCTCACTCGCCGC
CGCAAGTTCTGCTACGTCGTCGCCGTCTCCCGCGGCTGGAAGTACACGATCAGGACGACGTACTTCTACGGAGGAGTCAA
CGGGAAAGCCAACCCCCCGCCGGTGTTCGACCAGATCGTCGACGGGACGCTCTGGGGAGTCGTGAACACCACGGCGGACT
ACGCCGACGGGCTCGCCTCTTACTACGAAGGGGTGTTTCTTGCGCAGGGGAAGTCGTTGAGCGTCTGCGTGGCGTCCAAC
TCGTACACGGCTTCTGATCCGTTCATCTCGGCCTTGGAGGTTGTTAGGCTCGATGGCACTGTTTACAACTCCACTGAGTT
TGGAGGCTTTGGGCTTAGTCTTGTTGCTAGGCATGCTTTTGGGTACAGTGGACCAATCATCAGGTTTCCAGATGATGAGT
TTGATAGGTTTTGGGAGCCCTACTCACTGAACTCGACAGTACCAAACAACAGGAAGCTAGAGGTTTCTGGTTTCTGGAAC
CTCCCGCCTTCGAGGATATTCAACACGGATCTAAGAGCTACTCAGGTTCAGCCTCTGGAGTTCACGTGGCCTCCAATGCC
GTTGAAAAACTCTGTTTATTATATCGCGCTGTACTTCGCTCATGACTCTGATTCGTTGGACGGTGGTGGATCCAGAGTGT
TTGATGTTTCTGTGAACGGCGTAACGTATTATAAAGAGCTCTCTGTTGCTCCGGCTGGTGCGGTTATATTCGCGAGCAGG
TGGCCTCTTGAAGGTCAAACGACGTTAAAGTTGAGTCCTAGAAGTGGCTCAACGCTTCCCCCTCTTATCAATGGTGGTGA
GATGTTTGAGTTGATAGCTCGTGGAGGGAGAACTCTTGTTCGAGATGCGACTGCTCTTAATGCTATTAAAAGAAGTTTCG
AGAACGTACCGGTTGATTGGAGTGGAGATCCTTGTATGCCTAAAAACTACTCGTGGACTGGAGTTACCTGCTCTGAAGGT
CCCCGAATACGCATAGTAGCTTTGAACTTAACGAATATGGGACTTTCAGGTTCGCTAGCACCTGAAGTTGCAAGATTAAC
AGCATTGTCCTCCATTTGGCTGGGAAACAATTCTCTCTCGGGAAGTATACCCGACTTCGGCTCACTCAAACTGCTGGAAT
CAGTGCACTTGGAAGACAACCGTTTCAGTGGACCTTTTCCTTCATTTTTCGGTGGAGTGCCACGCTTGCGAGAGCTGTTC
TTGCAAAACAATAACCTAACAGGCCAAGTTCCAAGCAATCTTCTTCAGAAGCCAGGACTTGAGCTACGGATTTCTGGTAA
TCCCTTTCTGACTCAACCGCCACGTTGA