Details for Kale Locus Bo5g144870

Position : C5 ( 5`- 44755075 .. 44761133 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g144870

Protein [Map View]
MSDHVERRYEHQPRNAPRLEWQPVRAAERRTDIQARPVVGQENERDAVPETEEERRRRIKGKSIVGTTCEKEDNQGPMRV
ASGVLKISEPIPMQIPENQVYVEKGGAKSNIEKANEVLQKSSINVDLSSPGIRDKREQEIAKGKTGHGDKETTEDDQQLM
SEEEINQMMDQYASVNLYMDEEMLEDDDLLDESMEEDVVIPETQEVAKQTQQEKRGEDQALGGVGKEKEKIERAGTKASE
ELDRSKRGPPEKQQHTITNKRRGMRSPDPKGIAASRKLASRGRVSPKGKQAKQGRLHPGRVSGATVVPRIERRTLLVNMR
NKTKELEVKMAETSLTKKEAMKENESESTCPDMKLRVPVSKSFSSFNFMTIINLSYTNLENEGAIALVNALENSAPSLKA
IEVAGNNITYEAAPDISACLAAKRHLKRLNLSNNDLKDEGCFEIAYIMEPLEVKYVDMSNNNLTREGALSLALVAVKKEG
FEMLNIDGNTISFEGIEEIMEIFKNCPKLLGPFDENDPYEGDEDDVDDDDDDQEWESESLHEDFEDEFVSVFYFY*

DNA
ATGAGTGATCACGTTGAGAGAAGATACGAACACCAACCAAGGAATGCGCCTAGGTTGGAATGGCAACCAGTCCGTGCAGC
AGAAAGAAGGACAGATATACAGGCCAGGCCAGTGGTTGGACAGGAAAATGAGCGTGATGCAGTGCCGGAAACAGAGGAGG
AACGAAGGCGAAGAATCAAAGGAAAATCCATTGTAGGGACAACTTGTGAGAAAGAAGACAACCAGGGTCCCATGCGTGTA
GCTAGTGGAGTTCTTAAAATTTCTGAACCAATTCCCATGCAGATCCCTGAGAATCAGGTGTACGTGGAAAAGGGTGGGGC
AAAATCTAACATAGAGAAAGCCAATGAAGTGCTACAGAAGTCATCTATAAATGTGGATCTTTCCTCACCTGGAATAAGAG
ACAAGCGGGAACAAGAAATAGCGAAAGGAAAAACAGGACATGGAGATAAAGAAACAACTGAGGATGATCAACAGCTAATG
AGTGAGGAGGAGATAAATCAAATGATGGACCAATATGCAAGTGTTAATTTGTATATGGACGAAGAAATGCTAGAAGATGA
TGATCTCCTTGATGAAAGCATGGAGGAGGATGTAGTGATACCAGAAACTCAGGAGGTTGCAAAACAAACTCAGCAGGAGA
AAAGGGGAGAGGATCAAGCTCTGGGAGGGGTAGGAAAAGAGAAAGAAAAGATAGAAAGAGCAGGAACAAAAGCAAGCGAG
GAGCTGGATAGATCCAAAAGAGGCCCGCCAGAGAAACAACAACACACTATCACTAATAAGCGTCGGGGAATGAGAAGCCC
AGATCCAAAAGGAATAGCAGCGTCAAGGAAGCTCGCAAGCAGAGGGCGTGTTTCTCCTAAAGGCAAACAGGCTAAACAAG
GGCGTCTACATCCCGGGAGAGTTTCAGGCGCAACAGTGGTCCCTCGTATTGAGAGACGGACTCTTTTGGTTAACATGAGA
AACAAAACAAAGGAGCTGGAGGTGAAGATGGCGGAGACTAGCTTAACCAAGAAGGAGGCTATGAAAGAGAATGAATCTGA
GAGTACTTGTCCTGACATGAAACTTAGAGTTCCTGTGAGCAAATCATTTTCAAGCTTCAATTTCATGACTATAATCAACC
TAAGTTATACCAACCTAGAGAATGAAGGTGCTATAGCTCTAGTAAACGCTCTCGAGAACTCTGCTCCATCTCTTAAAGCT
ATAGAAGTGGCTGGAAACAACATAACCTATGAGGCGGCTCCAGATATCTCAGCTTGTTTGGCAGCAAAGAGGCATCTCAA
AAGGTTGAACCTGTCGAATAATGACCTTAAAGATGAGGGATGTTTTGAGATTGCTTATATTATGGAACCTTTGGAGGTGA
AATACGTTGATATGAGCAATAATAACCTGACCAGAGAAGGAGCATTGAGCTTGGCTCTTGTTGCTGTCAAGAAAGAAGGT
TTCGAGATGTTGAACATTGATGGGAACACGATTTCATTTGAAGGCATAGAGGAAATTATGGAGATATTCAAGAATTGTCC
TAAGTTGCTTGGACCGTTTGATGAGAATGACCCTTATGAAGGTGATGAAGATGATGTGGATGATGATGATGATGATCAAG
AGTGGGAAAGTGAGAGTCTTCATGAAGATTTTGAAGATGAATTTGTGAGTGTGTTTTACTTTTATTAG