Details for Kale Locus Bo5g144860

Position : C5 ( 5`- 44736615 .. 44737496 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g144860

Protein [Map View]
MATVVYQGYQSHFESQHFEPRALRLRLSSPNNPHSSTPLKSHFLDSSITPQDNISTSNAASLPSPAPKPSSSSESWLETI
SNSSSDEKDKKTLLPYVHSPSSRRTLSDESLALCTESLGSETGSDVITDQDLFSVSSELQTMETRTSTTTSRTPRQDRKR
DLLASLPPPLTTMRGFDCIQVKSHRENGRLVMTAVKPLPRDRCLQDRSNGCVRLAFLVDSDDHKEIETKEEEETTEIGRD
NEEAIQEYQAEEVEEEDNEVMIIDNIQRSSRCHEGDRENRGFLTWESLCVATS*

DNA
ATGGCAACTGTTGTATATCAAGGGTATCAATCTCATTTTGAGTCTCAGCACTTTGAGCCAAGAGCTCTAAGACTTAGACT
CTCTTCTCCTAACAATCCTCACTCATCCACACCTCTCAAATCCCATTTCCTTGACTCATCCATCACTCCACAAGACAACA
TCTCTACCTCTAATGCAGCTTCCTTGCCCTCGCCAGCTCCTAAACCGAGCTCTAGCTCGGAAAGTTGGCTCGAGACCATC
TCAAACTCGAGCTCTGATGAAAAAGACAAGAAGACATTACTTCCCTACGTTCATTCTCCATCTTCCCGTAGAACTCTCAG
CGATGAGAGCTTAGCATTGTGCACTGAAAGCCTCGGTAGCGAGACGGGCTCTGATGTTATTACCGATCAAGATTTGTTCT
CGGTTTCATCCGAATTACAAACCATGGAAACTAGAACTTCGACCACCACATCAAGAACACCAAGACAAGATAGGAAGAGA
GATTTGTTGGCTTCACTTCCACCTCCTTTGACAACTATGAGAGGATTTGATTGCATTCAAGTCAAGTCCCACCGCGAGAA
TGGAAGATTGGTGATGACGGCCGTGAAACCTCTGCCGCGGGATAGATGCTTACAGGACCGAAGTAATGGCTGCGTCCGGC
TCGCGTTCTTGGTTGATTCTGATGACCACAAAGAGATAGAGACCAAAGAAGAAGAAGAAACGACCGAGATAGGGAGAGAT
AACGAAGAAGCGATTCAAGAATACCAGGCAGAAGAAGTTGAAGAAGAAGACAACGAAGTGATGATTATTGATAACATTCA
AAGATCAAGTAGATGTCATGAAGGAGATCGAGAAAACAGAGGATTTCTAACATGGGAATCTTTATGTGTTGCCACTTCTT
AA