Details for Kale Locus Bo5g144830

Position : C5 ( 5`- 44723553 .. 44724125 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g144830

Protein [Map View]
MKKLISLVRNVHSRQCQPKLNWSAQVRFLQQDTVSKPKPKKYKYPSFYDPYGPRPQPSSKIVELAERIAALSPEERKQIG
PALNEHLRLPKQQMISIQGMLSVGAKQEAGAGKVEEKKEKTSFDVKLEKFDTAAKIKVIKEVRAFTSLGLKEAKELVEKV
PVVIKQGLTKEEANGIIEKIKAVGGVAVME*

DNA
ATGAAGAAGCTTATATCACTTGTCAGGAACGTTCACTCGCGCCAATGCCAACCCAAACTAAACTGGTCTGCGCAAGTGCG
TTTCTTGCAGCAAGACACTGTATCCAAACCCAAACCCAAGAAATACAAATACCCATCATTTTACGATCCCTACGGTCCTA
GACCCCAGCCTTCAAGCAAGATCGTGGAGCTAGCTGAGCGTATAGCTGCGCTATCTCCAGAGGAGCGGAAACAGATCGGT
CCCGCGCTCAACGAACACCTCAGGCTCCCGAAACAGCAGATGATTTCGATTCAAGGCATGTTGAGTGTGGGAGCGAAACA
AGAGGCTGGAGCAGGGAAAGTTGAGGAGAAGAAGGAGAAGACGTCTTTCGACGTGAAGCTGGAGAAGTTTGATACAGCTG
CGAAGATCAAAGTGATCAAAGAAGTGAGAGCGTTCACGAGTTTGGGTCTCAAGGAGGCGAAGGAGCTTGTGGAGAAAGTC
CCTGTGGTGATTAAACAAGGTCTGACGAAGGAGGAAGCTAATGGAATCATAGAGAAGATCAAAGCTGTAGGTGGAGTCGC
GGTTATGGAGTAA