Details for Kale Locus Bo5g144820

Position : C5 ( 5`- 44721040 .. 44722298 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g144820

Protein [Map View]
MSILKLRNSPALRSAASIARIGVSSRAFSKLSEGTDITSAAPGVSLQKARSWDEGVSSKFSTTPLSDIFKGKKVVIFGLP
GGAYTGVCSQQHVPSYKSHMDKFKAKGIDSVICVSVNDPYTLNGWAEKIGAKDAIEFYGDFDGKFHKSLGLDKDLSAALL
GPRSERWSAYVEDGKVKAVNVEEAPSDFKVTGAEVILGQI*

DNA
ATGTCTATTCTGAAGCTAAGAAACTCACCGGCTTTGAGATCCGCCGCAAGTATCGCCCGGATCGGAGTTTCATCAAGGGC
TTTCTCAAAGCTATCGGAGGGCACAGACATAACCTCGGCGGCGCCAGGCGTTTCACTCCAGAAAGCTCGCAGCTGGGACG
AAGGCGTTTCCTCCAAATTCTCCACCACACCATTGTCAGATATCTTCAAGGGGAAGAAAGTCGTCATCTTTGGACTTCCT
GGTGGTGCTTACACAGGAGTTTGTTCACAGCAGCATGTGCCAAGCTACAAGAGCCACATGGATAAGTTCAAAGCCAAAGG
CATTGACTCCGTCATCTGTGTTTCTGTCAATGATCCGTATACTTTAAACGGTTGGGCAGAGAAGATTGGTGCCAAAGATG
CTATTGAGTTTTATGGAGATTTTGATGGGAAATTCCATAAAAGCTTGGGGCTAGACAAGGATCTCTCTGCTGCATTGCTC
GGCCCTCGGTCTGAGAGATGGTCGGCTTATGTAGAAGACGGTAAGGTGAAGGCTGTGAACGTGGAAGAAGCACCATCTGA
CTTCAAGGTGACGGGAGCCGAAGTCATTTTAGGACAGATCTAA