Details for Kale Locus Bo5g144810

Position : C5 ( 5`- 44718875 .. 44720567 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g144810

Protein [Map View]
MSPSFLLLLIPIVPLSLLAFLALIVRPKPIRIPIKSRHVFITGGSSGIGLALAHRAASEGARVSILARSPQKLEEAKQSI
KLATGVEVAIFSADVRDYDAVSRAVEESGPIDVLIVNQGVFTARELERHSVEDVKFTIEVNLVGSFNVIKAALPGMKGRE
GRGPGSISLVSSQAGQVGVYGYSAYSASKFGLQGLAQSLQQEVVADDIHVTLVFPPDTDTPGFEEEQKSRPEVTAIIAAS
SGSMKTEEVARRAMEGIKAGKFTVSCNFEGFLLSLATTGMSPQRSFWLAFLEVITAGPIRLVALFFQWDWYNAIEKWSKT
KNK*

DNA
ATGTCTCCTTCCTTCCTCCTCCTCCTCATCCCCATCGTCCCACTCTCCCTTCTCGCGTTCTTAGCCCTAATCGTCCGCCC
CAAACCCATCAGAATCCCCATCAAGTCCCGCCACGTCTTCATCACCGGCGGATCCAGCGGCATCGGCCTCGCCCTAGCCC
ACCGCGCGGCCTCTGAAGGCGCTCGCGTCTCCATCCTCGCTCGATCCCCCCAAAAGCTCGAAGAAGCCAAACAATCCATA
AAACTCGCCACCGGAGTCGAAGTCGCAATTTTCTCCGCCGACGTCCGCGACTACGACGCCGTTTCGAGGGCGGTTGAGGA
ATCTGGCCCGATCGACGTGTTGATCGTCAATCAAGGGGTGTTCACGGCGAGGGAGCTCGAGAGGCATAGCGTGGAGGATG
TGAAGTTCACGATCGAGGTTAATCTCGTCGGGAGCTTTAATGTGATCAAGGCGGCTTTGCCGGGGATGAAAGGAAGGGAA
GGTCGTGGGCCTGGTTCGATCTCTCTAGTTTCATCTCAGGCTGGTCAGGTGGGTGTTTATGGTTATTCTGCGTATTCAGC
GAGCAAGTTTGGGCTTCAAGGTTTAGCGCAGTCGCTGCAGCAAGAAGTTGTTGCTGATGATATTCATGTCACTCTTGTTT
TTCCTCCTGACACTGATACACCCGGGTTCGAGGAAGAGCAGAAGAGCAGACCTGAGGTGACTGCCATAATAGCCGCGTCC
TCTGGTTCTATGAAAACAGAAGAAGTGGCCAGAAGAGCTATGGAAGGCATCAAAGCAGGAAAGTTCACTGTCTCATGCAA
CTTTGAAGGATTCTTACTGTCCCTCGCCACAACCGGCATGTCACCACAAAGATCATTTTGGCTAGCTTTTCTTGAAGTTA
TTACCGCAGGGCCTATAAGGCTGGTCGCACTCTTTTTCCAATGGGACTGGTACAATGCCATCGAAAAGTGGAGCAAAACC
AAAAACAAATAA