Details for Kale Locus Bo5g144800

Position : C5 ( 5`- 44717100 .. 44717632 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g144800

Protein [Map View]
MAMELELDDDVFYADISKQINLLITDEDEQNPISLSSPISFQGLFRENYQASATPYMMYHEQNYNQVKESKGTGVFIPRC
SQPRRRQHNHPHQKKQGRFGSLTPKQQYPHHVYDNNNNSTTFNNVESITLHHAASTNQRRTYRDAASLFT*

DNA
ATGGCTATGGAACTTGAGCTTGATGATGATGTCTTCTATGCAGACATAAGCAAGCAAATCAATCTCTTAATCACAGATGA
AGATGAACAGAACCCTATCTCACTTTCCTCTCCTATCTCATTCCAGGGTTTGTTCAGAGAAAACTACCAAGCCTCAGCAA
CACCATATATGATGTACCATGAGCAGAATTACAACCAAGTTAAAGAGAGCAAAGGGACAGGAGTGTTCATCCCAAGATGT
TCTCAGCCAAGAAGGAGACAACATAATCATCCTCATCAGAAGAAGCAAGGGAGATTCGGTTCCCTCACCCCCAAGCAACA
GTATCCTCATCATGTTTATGACAACAACAACAACTCCACAACTTTCAACAACGTAGAAAGCATCACCCTACATCATGCAG
CTTCTACTAACCAAAGAAGAACCTACAGAGATGCAGCATCTCTCTTCACTTAA