Details for Kale Locus Bo5g144790

Position : C5 ( 5`- 44702637 .. 44705034 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g144790

Protein [Map View]
MSKNSPVEEEKPISEALKRFKRSRLVLEPSLGVLGFFLVGLCLVWSFFYFDYRTAAKSYNLSDKSDRFVWLKLENNKSST
TISSNRVGFLEESGDECDVFDGDWVWDESYPLYRSKDCRFLDEGFRCSEFGRSDLFYTQWRWQPRHCNLPRFDAKLMLEK
LRDKRLVFVGDSIGRNQWESLLCLLSSAVKNESSVYEVNGSPITKHTGYLVFRFKDYNCTVEYYRSPFLVPQGRPPRGSH
KKVKTALKLDTMEWTSSKWRGADVLVFNTGHWWNYGKTIRTGCYFQEGGEVKLKMNVDDAYERALETVMKWIHTEVDSNK
TRVFFRTFAPVHFRGGDWRTGGTCHMETLPEIGTTSLVSSETWEQLKILGDALSHYSNRSETVKLKALNITAMSAQRKDG
HPSIYYLGSLGPAPLHRQDCSHWCLPGVPDTWNELMYALFMKQEASSSRRVKEANVTVS*

DNA
ATGTCCAAGAACTCACCAGTCGAAGAAGAGAAGCCAATCTCCGAAGCTCTGAAGAGATTCAAGAGGTCGAGGCTCGTCCT
CGAGCCGTCTCTAGGAGTGTTGGGCTTCTTCTTAGTCGGTCTCTGTCTCGTATGGAGCTTCTTCTACTTCGATTACCGAA
CCGCGGCGAAAAGCTACAACCTTTCTGATAAATCAGACAGATTCGTTTGGCTCAAACTCGAAAACAACAAGAGTAGCACT
ACTATTAGTTCAAACAGAGTTGGGTTTCTAGAAGAGAGTGGAGACGAGTGCGATGTCTTCGACGGAGACTGGGTCTGGGA
CGAGTCGTATCCTCTGTATCGATCCAAAGATTGTAGATTTCTCGATGAAGGGTTTAGGTGTAGCGAGTTTGGTAGGTCTG
ATTTGTTTTATACTCAGTGGAGATGGCAACCGAGACACTGTAATTTGCCTAGGTTTGATGCTAAACTGATGCTGGAGAAG
CTAAGGGACAAGAGGCTTGTGTTTGTTGGAGACTCAATAGGAAGGAACCAATGGGAGTCTCTTCTCTGTCTACTCTCTTC
TGCTGTCAAGAACGAGAGCTCGGTCTACGAAGTGAATGGGAGTCCCATCACAAAGCACACTGGTTACTTAGTGTTTAGAT
TCAAGGACTACAACTGCACGGTGGAGTACTACAGATCTCCATTCTTGGTTCCACAAGGCAGACCACCGAGAGGTTCACAC
AAGAAGGTTAAGACAGCTTTGAAGCTGGACACTATGGAATGGACTTCTAGCAAGTGGAGAGGTGCGGATGTTTTGGTGTT
TAATACGGGGCATTGGTGGAACTATGGGAAGACTATTAGAACGGGATGCTACTTTCAAGAAGGAGGAGAAGTGAAGTTGA
AGATGAATGTGGATGATGCGTATGAGCGAGCTTTGGAGACGGTTATGAAATGGATACATACCGAAGTCGATTCTAATAAA
ACTCGAGTCTTCTTTCGAACATTCGCCCCTGTGCATTTCAGGGGAGGAGATTGGAGAACGGGAGGAACATGTCACATGGA
GACACTACCTGAGATTGGAACTACCTCATTGGTTTCATCAGAGACATGGGAACAGTTAAAGATCCTAGGAGATGCGTTAT
CACATTACTCCAACAGATCAGAAACTGTTAAGTTGAAAGCGTTGAACATCACAGCAATGTCTGCTCAAAGAAAAGATGGT
CACCCGTCGATTTACTATCTAGGCTCTCTTGGTCCTGCACCGCTTCATCGCCAAGACTGTAGCCACTGGTGCCTTCCCGG
TGTTCCTGACACGTGGAACGAGCTCATGTATGCGTTGTTTATGAAACAAGAAGCTTCTTCTTCTAGAAGAGTCAAGGAAG
CAAATGTCACAGTGTCATGA