Details for Kale Locus Bo5g144780

Position : C5 ( 5`- 44696743 .. 44696916 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g144780

Protein [Map View]
MATYHGCGPCGEVSEKTMRMSVIGEASRNKFGNDKNKVKFSLGRKLVSGPSRRGCGH*

DNA
ATGGCTACTTATCATGGTTGTGGTCCTTGTGGAGAAGTTTCAGAGAAGACAATGAGGATGAGTGTGATTGGTGAAGCTTC
AAGAAACAAGTTTGGGAACGACAAGAACAAGGTGAAGTTTTCGTTGGGTCGTAAGTTAGTTTCTGGTCCAAGTCGTAGAG
GCTGCGGCCACTAA