Details for Kale Locus Bo5g144760

Position : C5 ( 5`- 44692518 .. 44693790 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g144760

Protein [Map View]
MHQPGIEPGSVPWQVELEKMEKVVDLFGVGEANTQKLLEGGNDLSQIQQGLFIGSVAEANNKDLLKSSNVTHVLTIAVAL
SPPYPDDFVYKVLEVVDRSETDLTVYFDECYSFIDQAIESGGGVLVHCFMGVSRSVTIVVAYLMRKHGIGFSKAMELVKS
RRPQAMPNFGFVSQLQQFEKSIKVHDEASSSVDNKEIVV*

DNA
ATGCACCAGCCGGGAATCGAACCCGGGTCTGTACCGTGGCAGGTGGAGCTAGAGAAGATGGAGAAAGTGGTAGATCTCTT
CGGAGTGGGAGAAGCCAATACCCAGAAGCTACTCGAAGGAGGCAACGATCTCAGCCAAATCCAGCAGGGACTCTTCATAG
GTTCAGTAGCTGAAGCGAACAACAAAGATTTGCTCAAAAGCTCCAACGTCACTCATGTCTTAACCATAGCTGTCGCCTTG
TCCCCTCCTTACCCTGATGACTTTGTCTATAAAGTCCTCGAAGTTGTTGACAGATCCGAGACGGATTTGACTGTGTACTT
CGATGAGTGTTATAGCTTCATCGACCAAGCTATTGAATCTGGAGGTGGTGTTTTGGTCCATTGCTTCATGGGGGTTTCAC
GGAGTGTGACTATAGTGGTGGCTTATTTGATGAGAAAGCATGGGATTGGTTTCTCTAAAGCTATGGAGCTTGTAAAGAGT
AGACGACCTCAAGCAATGCCTAACTTTGGTTTCGTTTCTCAGCTGCAGCAGTTTGAAAAATCCATTAAAGTGCATGATGA
GGCTTCTTCTTCAGTGGATAATAAGGAGATAGTAGTATGA