Details for Kale Locus Bo5g144750

Position : C5 ( 5`- 44689187 .. 44690389 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g144750

Protein [Map View]
MSHIAVERNRRRQMNEHLKSLRSLTPCFYIKRGDQASIIGGVIEFIKEMQQLVQVLESKKRRKTLNRSSSPYDHQTIEPS
ILADTPNATTRMPFSKIENVMSLMTTSTFKEVGACSNSHHANVEAKISGSNVVLRVVSWRIEGQLVRIISVLEKLSFQVL
HLNISCMEESVLYFFVVKIGLECHLSLEELTLEVQKSFVPEAIV*

DNA
ATGTCTCACATCGCTGTTGAGAGGAACCGAAGAAGGCAGATGAACGAGCATCTTAAATCCCTTCGTTCTTTGACACCTTG
TTTCTACATCAAAAGGGGAGATCAAGCTTCAATAATCGGAGGAGTTATCGAGTTCATCAAAGAGATGCAGCAATTAGTGC
AAGTTCTCGAGTCCAAGAAACGTCGCAAGACACTAAACCGGTCTTCTTCTCCTTATGATCACCAAACAATCGAGCCATCC
ATCTTAGCTGACACCCCTAACGCAACCACCAGAATGCCGTTTAGTAAAATCGAGAATGTAATGAGTCTAATGACAACAAG
CACCTTCAAGGAAGTTGGAGCATGTTCCAACTCCCATCATGCAAACGTTGAAGCCAAGATCTCAGGCTCTAACGTTGTAT
TGAGAGTTGTCTCTTGGAGAATTGAGGGCCAGCTGGTGAGGATCATATCCGTCTTGGAGAAACTCTCTTTTCAGGTTCTT
CACCTCAACATTAGCTGCATGGAAGAGTCTGTCTTGTACTTCTTCGTTGTCAAGATAGGACTGGAGTGTCACTTAAGCTT
GGAGGAGCTAACCCTTGAAGTTCAGAAAAGCTTTGTGCCTGAAGCCATTGTCTAA