Details for Kale Locus Bo5g144740

Position : C5 ( 5`- 44678690 .. 44680354 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g144740

Protein [Map View]
MSKEEFMKIQTCVLKVNIHCDGCKQKVKKILQKIEGVFTTKIDSDQGKVTVSGNVDPSVLIKKLAKSGKHAEVWGAPKGN
NNNQNQLANQMKGMQIDNGKGVGGKNNNNNNKGPKNGGGGGGGGGGGGGNSNAPKMGQQLNPQQIQQLQQIQKMKGFQDL
KLPPQLKDSKGAAPPPNKNQKGVKFDVPEDDDDDDDFTDDDEFDDEFTDDDDEFDDDEFGDLPPPSNKMKPNMMMPNAQQ
MMMNAQKNANLGGKGGPGGGNGGGGGGKGGPGGSGGGKGAPGGGGNQNQGGGKNGGKNGGGGGGHPQDGKNGGGPNAGKK
GNGGGGGGGGGGPMAGGLPAGFRPMGGGGPQNMSMPMGGPMGMGGPMGNIPAVQGLPATGPGGGVPPGYFQGAGPDPMQM
QQQQQQQQYLAAVMNQQRAMGNERFQPMMYARPPPAVNYMPPHPPHQYPNPYPYPYPYPPHGNDQYSHVFSDENTSSCDI
M*

DNA
ATGAGTAAAGAAGAGTTTATGAAGATCCAGACTTGTGTTCTTAAAGTGAACATACACTGTGATGGATGTAAGCAGAAAGT
CAAGAAAATCTTGCAGAAAATCGAAGGTGTTTTCACGACCAAGATTGATTCAGACCAAGGGAAAGTGACTGTCTCCGGGA
ACGTAGATCCTTCAGTTCTCATCAAAAAGCTTGCAAAATCTGGTAAACATGCCGAAGTCTGGGGAGCTCCAAAGGGTAAC
AACAACAATCAGAATCAGTTGGCCAATCAGATGAAAGGGATGCAGATAGACAATGGAAAAGGTGTCGGTGGAAAGAACAA
TAACAACAACAATAAAGGTCCAAAGAACGGCGGTGGCGGTGGAGGAGGTGGAGGAGGCGGCGGAGGTAACAGTAACGCGC
CGAAGATGGGACAGCAACTGAATCCACAACAGATTCAGCAGCTTCAACAGATCCAGAAGATGAAAGGGTTTCAAGATCTG
AAGCTTCCTCCACAGTTGAAGGATTCCAAGGGCGCTGCTCCTCCTCCGAACAAGAACCAGAAAGGAGTGAAGTTTGATGT
TCCTGAGGATGATGATGATGATGATGACTTCACTGATGACGACGAGTTTGATGATGAGTTCACTGACGATGACGACGAGT
TTGATGACGACGAGTTTGGTGATCTCCCTCCTCCGTCTAATAAGATGAAGCCTAACATGATGATGCCTAACGCTCAGCAG
ATGATGATGAACGCTCAGAAGAACGCTAATCTTGGCGGTAAAGGTGGTCCCGGCGGTGGAAACGGCGGCGGCGGCGGTGG
TAAAGGTGGTCCCGGAGGCAGTGGCGGTGGAAAAGGTGCTCCTGGTGGCGGTGGGAATCAAAACCAGGGCGGAGGCAAGA
ACGGTGGTAAAAACGGTGGTGGTGGCGGTGGACATCCACAAGATGGTAAAAACGGCGGTGGTCCAAACGCCGGAAAGAAG
GGTAATGGCGGCGGAGGTGGAGGTGGAGGTGGTGGACCCATGGCGGGAGGACTGCCAGCCGGTTTCCGTCCCATGGGAGG
CGGAGGACCACAAAACATGAGCATGCCAATGGGCGGTCCAATGGGTATGGGTGGTCCGATGGGTAATATTCCGGCGGTTC
AAGGATTACCGGCAACCGGTCCAGGCGGTGGTGTACCACCAGGTTATTTCCAAGGAGCCGGGCCAGACCCTATGCAAATG
CAGCAACAACAACAACAGCAACAGTATTTAGCAGCGGTTATGAACCAGCAACGTGCCATGGGAAACGAGCGGTTCCAACC
AATGATGTACGCAAGGCCGCCACCGGCAGTTAACTACATGCCACCGCACCCGCCGCACCAATATCCAAACCCGTATCCGT
ACCCGTATCCATATCCACCTCATGGGAATGATCAGTACTCTCATGTCTTTAGCGATGAGAACACATCAAGCTGCGATATT
ATGTGA