Details for Kale Locus Bo5g144700

Position : C5 ( 5`- 44668328 .. 44668834 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g144700

Protein [Map View]
MKTTKVKFTKEMIESIKDKLPRLSFLLLFLRQCYGGCGDRAHLLPCSITTSSTRFWNLSDRPVELQIRVGSILKRVHTLK
PGRSKKLRHSSLHRAYVPDQEGRRWLYYDDTCLPYVWVHETGTDLSKMVKQQYVSLDDLRDCSEIRVFKDLQRGCVSVEK
RDRASALC*

DNA
ATGAAAACAACAAAAGTGAAGTTCACAAAAGAGATGATAGAGTCTATCAAAGACAAGCTCCCAAGGCTCAGCTTTCTCCT
CCTCTTCCTCCGACAATGTTACGGCGGTTGTGGAGACCGGGCACACTTACTCCCTTGCTCTATCACCACTTCCTCCACCC
GCTTCTGGAACCTCTCTGATCGTCCCGTGGAGCTTCAGATTCGAGTCGGGTCGATCCTTAAACGTGTCCACACTCTCAAA
CCGGGACGTTCCAAAAAGCTCAGGCACAGTAGCCTCCACAGAGCCTACGTTCCTGACCAGGAAGGACGTCGATGGCTGTA
CTACGACGACACGTGTTTACCGTACGTATGGGTTCATGAGACCGGTACGGACTTGTCAAAGATGGTGAAGCAACAGTACG
TGAGTCTCGATGATCTTAGGGATTGCTCGGAGATTAGGGTTTTTAAGGATTTACAGAGAGGTTGTGTCTCTGTTGAGAAG
AGAGACAGAGCTTCTGCTTTGTGTTGA