Details for Kale Locus Bo5g144680

Position : C5 ( 5`- 44655926 .. 44656879 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g144680

Protein [Map View]
MALVRNNRFMNLKLSLPQAPSTSLPCFIPIATASTTVTSNTSNTVSASDLERVNVLGFGSGGTVYKVSHKTTSATYALKK
VKEDMDSTSRHQLLREIEILRLVNSPYVVKCHDIYEKPSGEVSILMEYMDLGTLESLRGNVVKEEQLALIARQVLKGLSY
LHGLKIVHRDIKPANLLRNSRQEVKIADFGVSKIMVKSLDKSNTFTGTCAYMSPERFDSEAADVSEEDKSNVYAGDIWSF
GLTMLEILVGHFPLIPHGEKPDWATLMCAVCSGESPKAPEECSEELKSFIDCCLRKKPSERWTASQLLSHPFLLQQD*

DNA
ATGGCTTTGGTTAGAAACAATCGATTCATGAATCTCAAGCTTTCTCTTCCACAAGCTCCTTCCACTTCCCTCCCTTGCTT
CATCCCCATCGCAACAGCCTCCACAACAGTTACGTCCAACACAAGCAACACCGTCTCTGCTTCTGATTTGGAGAGAGTCA
ACGTTCTAGGCTTTGGAAGCGGTGGAACCGTCTACAAAGTCAGCCACAAGACAACCTCCGCGACCTACGCGTTGAAGAAG
GTCAAAGAAGACATGGATTCTACTTCCCGCCACCAACTCCTACGCGAGATAGAGATCCTCCGCCTTGTCAACTCTCCTTA
CGTTGTAAAGTGTCACGACATCTACGAGAAACCTTCCGGAGAAGTATCTATTCTGATGGAGTACATGGACCTAGGCACGC
TAGAGTCTCTACGTGGCAACGTCGTCAAAGAGGAACAGCTAGCTTTGATCGCACGTCAAGTTTTGAAAGGGTTAAGTTAC
TTGCATGGGCTCAAGATTGTTCATAGAGACATCAAGCCAGCGAACCTGCTACGTAACTCGAGGCAAGAGGTCAAGATCGC
AGACTTTGGAGTGAGCAAGATCATGGTCAAGTCGTTAGACAAAAGCAACACGTTCACCGGCACGTGCGCCTATATGAGCC
CCGAGAGATTCGACAGTGAAGCTGCTGATGTTTCGGAGGAAGACAAATCAAACGTTTACGCTGGAGATATTTGGAGTTTT
GGTCTGACCATGCTGGAGATCTTGGTCGGTCACTTCCCTCTGATTCCTCATGGAGAGAAACCAGATTGGGCCACGCTTAT
GTGCGCTGTGTGCTCTGGAGAATCACCGAAAGCTCCTGAGGAATGCTCTGAAGAGTTGAAGAGTTTTATTGATTGTTGTT
TACGCAAGAAACCTAGCGAGAGATGGACAGCTTCACAGCTTCTCAGCCACCCTTTTCTTCTCCAGCAAGATTAG