Details for Kale Locus Bo5g143650

Position : C5 ( 5`- 44627856 .. 44634484 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143650

Protein [Map View]
MAFKPFGKDVGPAMSSKQPSPFTTFGASDPTQSTSDSPIQPPTYQNHSGYAGPSFGPGGIQSGPPIQRAPSPSASQNPSP
RGLQSSPAMNRTSPPVAFQNPSHSSGQSYRPGGTQRSPGPVNVHWGPEAFPRPIPSVRPYQFPGVQRSYNSSRKTEQGLA
ECYRPTLNPQFGHDESRNFQKDHSERSLATSSASTSHTLSRSGTDVVEIGRSQDSKRKSRSDVLPDRSLGVSRRNHSPGS
GFGIGRLVDDFQQSSSQTWIRSPSSADNNPVRSRIIPNRLIHQEQSPSSSFPYANEAAEIQEATKRKSSAIAPSDSFLHN
NPVFSQDDTRRSSTSPPGTKSFMLSRSSDSQFTGQSSVNNFSNAVKTSSSPATKRTRSPPFYPVEDDIQGNSFLSQSFTE
GEEQARAKRLARFKGELDPVPARPESNRDVLKGDALSDFESSEQPSLIVGLCPDMCPESERGERERKGDLDHYERVDGDR
NQTSKSLAVKKYTRTVEREAILIRPMPILQNTMEYLLSLLDRPYNENFLGMYNFLWDRMRAIRMDLRMQHIFNREAITLL
EQMIRLHIIAMHELCEYTKGEGFSEGFDAHLNIEQMNKTSVELFQMYDDHRKRGTTIPTEKEFRGYYALLKLDKHPGYKV
EPSELSLDLANMTPEIRQTSEVLFARSVARACRTGNFIAFFRLARKASYLQACLMHAHFSKLRTQALASLHAGLLNNQGL
PVSDTSKWIGMEEEDIEALLEYHGFSIKVFEEPYMTEANKGYQQETPPPQSLKKQTSLRLVDKVMTDSKTSLLLEEDKPM
RTSVINPVRPSDEKPAVDQQNRNHFTPAGEFHSPGFPQAESLNLKKQPNGGHTSTSPAEIKFPFAEHMQTNLMPGSILQQ
KSPTRVENISALEESVPEAAMTVTLEEGFDDIEQEDEDGHEDITSQYEEEVAKAKLKLIIRLWKRWSSRQSELRERRQVA
AAAALNSLTLGTPIRLSKTDRACGEFDIDQAMKRRFEEREKSWSRLNISDVVADTLVERNPDSKCIWWKVILCTQSKSVD
TSSQNTHSAATRWLSSKLIPDTEHSISDDNLLFSSPGVSVWNKWVASGSDSDSRCCLSVARDVEADNDPRGASAVLFLAS
KSIPLNLQREHLNRILESVPNRSLLPLLVLTSSSNGESVGPDTNLVSELGLHDINKSKIASFITVVSIALITPRRDTKFV
FSAIRG*

DNA
ATGGCGTTTAAGCCTTTCGGGAAAGATGTAGGACCGGCGATGAGCTCCAAGCAGCCGTCGCCGTTTACAACGTTCGGCGC
TTCTGATCCTACTCAATCCACCAGTGATTCTCCGATTCAGCCACCGACATATCAAAACCATTCAGGGTATGCAGGACCAT
CTTTTGGACCAGGTGGTATTCAAAGTGGTCCTCCAATCCAGCGAGCACCGTCTCCTTCAGCTTCTCAAAACCCTTCACCA
CGTGGACTACAAAGTAGTCCTGCAATGAATCGAACATCACCACCTGTGGCTTTTCAAAATCCCTCCCACTCCTCAGGACA
ATCTTACCGACCTGGTGGAACTCAGAGGAGCCCCGGACCTGTCAATGTACATTGGGGTCCAGAAGCTTTTCCACGTCCAA
TCCCCTCTGTGAGACCTTACCAATTTCCTGGAGTTCAGAGATCGTATAATAGCAGTAGGAAGACAGAGCAGGGTTTGGCG
GAGTGCTACAGGCCTACTTTAAATCCTCAGTTTGGGCATGATGAATCTAGGAATTTCCAAAAGGATCATAGTGAACGTAG
TCTAGCCACGTCTTCAGCTAGTACATCACACACTCTTTCCAGAAGTGGAACTGATGTTGTTGAGATTGGTCGATCACAAG
ATTCAAAAAGGAAAAGTCGTTCAGATGTTCTTCCTGATCGGAGTTTAGGGGTTTCTCGAAGAAACCATTCGCCAGGATCA
GGTTTTGGGATTGGCAGATTGGTAGATGATTTCCAGCAGTCATCTAGTCAAACTTGGATACGCTCTCCCTCTTCCGCGGA
CAATAATCCGGTGAGGTCGAGGATCATTCCCAATCGGTTGATCCATCAGGAACAGAGCCCAAGCTCTTCATTCCCTTATG
CAAATGAAGCAGCTGAAATCCAGGAAGCCACAAAAAGAAAATCTTCGGCAATAGCACCTTCTGATAGTTTTCTTCATAAC
AACCCTGTATTTTCTCAAGATGATACTCGAAGGTCATCGACATCTCCTCCTGGCACAAAGTCATTTATGCTTTCAAGAAG
CTCAGATTCCCAATTTACTGGGCAGTCCTCTGTAAATAATTTCAGTAATGCGGTTAAGACAAGTAGTTCACCTGCAACAA
AAAGGACGAGATCTCCACCTTTTTATCCAGTGGAGGATGATATCCAGGGAAACTCTTTTCTTTCTCAAAGCTTTACTGAA
GGAGAAGAGCAAGCCAGGGCAAAGAGACTGGCCCGCTTCAAGGGTGAACTGGACCCTGTTCCAGCCCGACCTGAATCAAA
TAGGGATGTCCTCAAGGGAGATGCTTTGTCTGATTTTGAAAGCTCGGAGCAGCCTTCTCTTATCGTTGGATTATGCCCTG
ACATGTGTCCTGAGTCAGAACGGGGGGAGCGTGAAAGGAAGGGTGACTTGGACCATTATGAGCGTGTGGATGGAGATAGG
AACCAGACGAGCAAATCCCTTGCTGTGAAGAAATATACCAGGACGGTGGAGCGAGAAGCCATTTTGATACGACCCATGCC
AATCCTGCAGAATACCATGGAATATTTGCTGAGTTTGCTAGACCGCCCTTACAATGAAAACTTTCTTGGCATGTATAATT
TCCTATGGGATAGGATGAGAGCTATTCGAATGGATCTAAGAATGCAACATATATTCAACCGAGAAGCTATTACTTTACTG
GAGCAAATGATAAGACTTCACATCATTGCAATGCATGAGCTATGTGAATATACTAAAGGAGAGGGCTTTTCGGAGGGGTT
TGATGCACACCTGAATATTGAGCAGATGAACAAGACATCTGTTGAGTTGTTTCAAATGTATGATGATCACAGGAAGAGAG
GAACAACTATTCCTACAGAAAAAGAGTTCCGTGGCTATTATGCTCTTCTCAAACTCGACAAGCACCCTGGCTACAAGGTT
GAACCGTCTGAGCTTTCTCTTGATCTTGCCAACATGACTCCAGAAATAAGGCAAACTTCAGAAGTTCTCTTTGCCCGCAG
TGTAGCCAGAGCTTGTAGAACTGGCAACTTCATTGCCTTCTTTCGCCTCGCACGAAAAGCAAGTTATCTTCAAGCATGTC
TAATGCATGCTCATTTTTCAAAGCTAAGAACTCAGGCGCTTGCTTCTCTGCACGCGGGTCTCCTAAATAATCAGGGTCTC
CCAGTTTCAGATACTTCAAAGTGGATAGGGATGGAGGAAGAGGACATAGAAGCCCTGCTGGAGTACCATGGATTTTCGAT
AAAAGTGTTTGAAGAGCCATACATGACAGAAGCAAATAAAGGATATCAACAGGAAACACCGCCTCCTCAAAGTCTTAAGA
AACAAACATCACTGCGTCTAGTTGATAAAGTAATGACCGATTCCAAGACTTCCCTCTTACTGGAGGAGGACAAGCCAATG
AGGACATCTGTTATAAATCCAGTGCGGCCATCTGATGAAAAACCAGCAGTAGATCAACAAAACCGAAATCACTTTACACC
GGCTGGTGAATTTCATTCTCCTGGATTTCCTCAAGCTGAATCCTTGAATTTGAAGAAACAACCTAATGGCGGCCACACTA
GTACATCTCCCGCGGAAATTAAATTTCCATTTGCAGAGCATATGCAAACGAATCTTATGCCCGGTTCTATTTTGCAACAA
AAGTCTCCAACGCGTGTAGAAAACATATCTGCTTTGGAAGAATCAGTACCTGAAGCTGCGATGACTGTTACCTTGGAAGA
GGGTTTCGATGACATTGAACAGGAAGACGAGGATGGACATGAGGACATCACAAGTCAGTATGAAGAGGAAGTGGCGAAGG
CTAAGCTCAAGTTGATCATAAGATTATGGAAGCGGTGGTCTTCACGTCAAAGTGAATTGCGGGAGCGTCGACAAGTAGCT
GCAGCTGCTGCACTGAATTCTCTAACCCTGGGCACCCCTATCCGACTCAGCAAAACTGATAGGGCGTGCGGTGAGTTTGA
CATTGATCAAGCGATGAAGAGGAGATTTGAAGAACGGGAAAAATCATGGTCAAGGCTGAATATTTCAGATGTGGTAGCTG
ATACATTAGTCGAAAGGAATCCAGACTCAAAATGCATATGGTGGAAGGTTATCCTATGTACTCAGAGTAAATCAGTTGAC
ACATCAAGTCAAAACACACATTCAGCAGCCACTCGATGGTTATCATCAAAGCTTATCCCTGACACAGAACATAGTATCTC
CGATGATAATCTACTGTTTTCATCTCCCGGTGTGTCGGTATGGAATAAATGGGTTGCAAGTGGGTCTGATTCAGATTCCA
GATGCTGTCTCTCAGTAGCTAGGGATGTAGAAGCTGATAATGATCCACGTGGCGCAAGTGCAGTTCTCTTCCTTGCATCT
AAAAGCATCCCTCTGAATCTCCAGAGAGAACATCTTAACCGCATTCTCGAATCAGTACCTAACCGTTCACTCCTTCCCCT
TCTCGTTCTAACCAGCTCAAGCAATGGAGAAAGCGTGGGTCCCGATACAAATCTCGTCTCTGAGCTAGGCCTCCATGATA
TCAACAAATCAAAGATAGCAAGCTTCATCACCGTCGTTTCTATCGCTCTAATTACTCCCAGAAGGGACACGAAGTTCGTT
TTTTCAGCGATTCGCGGCTAA