Details for Kale Locus Bo5g143640

Position : C5 ( 5`- 44625719 .. 44627436 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143640

Protein [Map View]
MSMSRRGLIRMLLVAVFLVMLQSSTALISSPSSIINPSKVKQVSSKPRAFVYEGFLTDLECDHLISLARENLQRSAVADN
DNGDSQVSDVRTSSGTFISKGKDPIVSGIEDKLSTWTFLPKENGEDLQVLRYEHGQKYDAHFDYFHDKVNIARGGHRIAT
VLMYLSNVTKGGETVFPDAVESSRLKVSVNKDGLSDCAKKGIAVKPKKGDALLFFNLHQDATPDTLSLHGGCPVIEGEKW
SATKWIHVDSFDKIVTHDGSCADVNESCERWAVLGECAKNPEYMVGTPELPGNCRRSCKAC*

DNA
ATGTCAATGTCTCGCCGCGGATTGATTAGGATGTTGCTCGTCGCCGTCTTCCTCGTCATGCTTCAGTCATCAACTGCTCT
GATTAGTTCTCCGAGTTCTATCATCAACCCTTCTAAAGTCAAACAAGTTTCTTCAAAACCCAGGGCATTTGTGTATGAAG
GTTTTCTAACGGACCTGGAATGTGATCATCTGATCTCCCTTGCGAGAGAGAATCTGCAGAGATCTGCGGTTGCTGATAAC
GACAATGGGGACAGTCAAGTCAGTGACGTTCGGACCAGCTCCGGCACGTTTATCTCCAAAGGAAAGGATCCTATTGTTTC
CGGTATAGAGGATAAGCTCTCCACATGGACATTCCTCCCAAAAGAAAATGGAGAAGACCTTCAGGTGCTAAGATATGAGC
ACGGTCAAAAATACGACGCTCACTTTGACTACTTCCACGACAAAGTCAACATCGCCCGTGGTGGACACCGCATTGCAACC
GTTCTCATGTATCTCTCCAATGTCACAAAGGGTGGAGAAACTGTTTTCCCTGATGCAGTGGAGTCTTCCCGCCTCAAGGT
TTCTGTAAACAAAGACGGCCTTTCTGATTGCGCAAAGAAAGGAATTGCTGTGAAACCGAAGAAAGGAGATGCACTGCTGT
TCTTCAACCTCCACCAAGACGCAACCCCAGATACATTAAGCCTTCACGGAGGCTGTCCTGTGATCGAAGGAGAGAAATGG
TCAGCGACCAAGTGGATCCACGTGGACTCGTTCGATAAGATTGTGACGCATGACGGTAGCTGTGCGGATGTAAACGAGAG
CTGTGAGAGATGGGCGGTGCTTGGAGAGTGCGCAAAGAATCCAGAGTATATGGTGGGAACTCCAGAGCTCCCTGGAAACT
GCAGGCGTAGCTGCAAAGCTTGTTAA