Details for Kale Locus Bo5g143590

Position : C5 ( 5`- 44587527 .. 44591527 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143590

Protein [Map View]
MAPSSSANVRPSHILSIPRPSPTCVPNLRLLASGFSLIFKSSYLSAELSSRQTRSVQVPVVSSTRMQRRSMEQSNVYVAS
NSMETEIGSQEITKNPSLICAPVMADSINKMVTETCKARELGADLVEIRLDSLKGFNPLEDLKTIIKKSPLPTLFTYRPK
WEGGQYDGDDNERLDVLRLAMELGADYIDVELQVASEFIKSIKGKKPKNFRVIVSSHNYQNTPSLEDLNDLAVSIQRAGA
DIVKIVTTAVDITDVARMFHITSNSQIPTIGLVMGQRGLMSHILCSKFGGYLTFGTLESGKVSASGQPTIKDLLDLYNFR
RIGPDTKVYGVIGQPVSHSKSPVVHNQAFKSVDFNGVYVHLLVDDIASFLKAYSSSDFVGFSCGIPHKEAALTCCDEVDP
LAKSIGAVNTILRRQSDGKLMGYNTDCIGSISAIEDGLRSSSHPSSVRCTSASPLAGKTVVVIGAGGAGKAVAYGAKVKG
AKVVIANRTYERALEVAEAIGGRAVSLADLESFHPEDGMVLANTTSVGMQPNVDETPISKYALKHYALVFDAVYTPRVTR
LLREAEECGAVTVSGSEMFVRQAYEQFEIFTGLPAPKELYWEVMSKY*

DNA
ATGGCTCCTTCTTCTTCAGCTAATGTTCGCCCTTCTCATATCCTCTCCATCCCACGACCGTCACCGACCTGCGTTCCCAA
CCTCCGTCTCCTGGCCTCCGGTTTCAGTCTCATCTTCAAATCGAGTTACTTATCCGCCGAACTCTCTTCCCGGCAAACCA
GGAGTGTGCAGGTTCCTGTAGTTTCCTCCACTCGAATGCAACGTCGAAGCATGGAACAAAGCAATGTCTATGTGGCTTCA
AATTCTATGGAAACGGAGATTGGAAGTCAAGAAATCACCAAGAATCCGAGCTTGATCTGTGCTCCAGTGATGGCGGATTC
AATAAACAAGATGGTGACTGAAACGTGCAAAGCACGTGAACTGGGTGCAGATTTGGTGGAAATTCGATTAGATAGTCTCA
AGGGTTTCAACCCTCTTGAGGATCTTAAAACAATCATTAAAAAATCTCCTCTTCCCACTCTATTCACCTACAGACCAAAA
TGGGAAGGTGGTCAATATGACGGCGATGATAATGAGCGGCTGGATGTGCTCCGTTTGGCCATGGAACTAGGAGCTGATTA
CATTGATGTTGAACTTCAGGTTGCAAGTGAGTTCATCAAATCGATTAAAGGAAAGAAGCCTAAAAATTTTAGAGTTATTG
TTTCATCACACAACTATCAGAATACCCCTTCCCTTGAGGATCTCAATGACCTTGCTGTAAGCATACAACGGGCTGGAGCC
GACATAGTGAAAATTGTTACTACTGCTGTGGACATCACAGATGTTGCTCGCATGTTCCATATAACTTCAAATTCTCAAAT
TCCCACAATAGGACTTGTTATGGGTCAAAGGGGTCTAATGTCTCACATTCTTTGTTCGAAATTTGGTGGATATTTGACCT
TTGGCACCTTGGAATCCGGAAAAGTTTCTGCATCTGGTCAACCAACGATCAAGGATCTGTTGGATCTTTACAACTTTAGA
AGAATTGGTCCTGACACTAAGGTTTATGGAGTTATTGGCCAGCCTGTCAGTCACAGCAAATCACCTGTTGTCCACAATCA
AGCTTTCAAATCAGTTGATTTTAATGGAGTATATGTTCACCTATTAGTTGATGATATTGCAAGCTTTCTCAAAGCATACT
CATCCTCTGATTTCGTTGGATTCAGCTGTGGAATTCCTCACAAAGAAGCTGCATTGACATGTTGTGATGAGGTTGATCCA
TTGGCAAAGTCTATAGGAGCTGTGAACACTATACTAAGGAGACAAAGTGATGGAAAGTTGATGGGTTACAACACGGATTG
TATTGGTTCCATTTCTGCTATTGAGGATGGCCTTCGAAGCTCAAGTCATCCGAGCAGTGTACGTTGTACATCTGCTTCGC
CATTAGCCGGTAAAACAGTGGTGGTTATTGGTGCTGGTGGAGCAGGCAAGGCAGTTGCTTATGGTGCAAAAGTGAAGGGG
GCCAAAGTTGTAATTGCTAATCGAACTTATGAACGAGCACTAGAGGTTGCAGAAGCAATCGGAGGCAGAGCGGTATCTCT
AGCGGATTTAGAGAGCTTCCATCCAGAAGACGGCATGGTTTTGGCCAACACCACTTCTGTAGGTATGCAACCAAATGTCG
ATGAGACTCCCATTTCCAAGTATGCATTGAAGCACTACGCACTAGTATTTGATGCGGTGTATACTCCAAGAGTCACCAGA
CTGTTACGGGAAGCAGAAGAATGTGGAGCCGTAACAGTGTCGGGGTCAGAGATGTTTGTGAGACAGGCTTACGAGCAGTT
TGAGATTTTCACTGGTTTGCCCGCTCCAAAGGAACTCTACTGGGAGGTCATGTCAAAGTACTGA