Details for Kale Locus Bo5g143580

Position : C5 ( 5`- 44578062 .. 44580999 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143580

Protein [Map View]
MAFGLLNTMLEKSETLLGSDHASVVSMNLFVALLCACIVLGHLLEETRWMNESITALIIGSCTGIVILLISGGKSSRILV
FSEDLFFIYLLPPIIFNAGFQVKKKQFFRNFMTIMLFGAIGTLISFAIISLGAMHFFEKMNIGDLTISDYLAIGAIFSAT
DSVCTLQVLNKDETPLLYSLVFGEGVVNDATSVVLFNAIQRFDLTHINSTIVLEFAGNFFSLFILSTALGVAAGLLSAFT
IKKLYFGKIKHSTDREVALMMLIAYLSYMLAELFHLSSILTVFFCGITMSHYTWHNVTDKSKVTTKHTFAALSFLAEIFI
FLYVGMDALDIEKWDVVRNSPGQSIGVSAILLGLILLGRAAFVFPLSFLSNLTKSSPDEKIDWKKQVTIWWAGLMRGAVS
MALAYNQFTTSGHTKLLGNAIMITSTITVVLFSTVVFGLLTKPLVKHLQPPSKKPSTPMSSFHEPLLNGDGDSSYIENHE
PLHRTQGQSDYILEQITLRMFLSTPSRAIHHYWRRFDNAVMRRIFGGRGVSEVVPGSPIDTSVRQLWTEDVENKEQYAEP
*

DNA
ATGGCATTTGGACTACTAAACACCATGTTGGAAAAGTCAGAGACTTTGTTGGGGTCAGATCATGCATCAGTCGTATCCAT
GAACTTGTTCGTGGCTCTGCTTTGTGCTTGCATCGTGCTCGGTCACTTACTAGAGGAGACTCGGTGGATGAATGAGTCAA
TCACCGCTCTTATCATTGGTTCATGTACTGGCATTGTGATCTTGCTTATAAGTGGAGGAAAGAGCTCGAGGATCCTGGTG
TTTAGTGAAGATCTCTTCTTCATTTATCTTCTTCCACCGATCATATTCAATGCAGGGTTTCAGGTTAAGAAGAAGCAATT
TTTCCGTAACTTCATGACCATTATGTTGTTTGGTGCTATTGGCACTCTCATTTCATTTGCTATCATATCATTAGGTGCAA
TGCATTTTTTCGAGAAAATGAATATCGGAGATCTTACCATTTCGGATTATCTAGCCATTGGAGCTATATTCTCTGCTACA
GATTCTGTTTGCACCTTGCAAGTGCTTAATAAAGATGAGACACCTCTCTTGTACAGTCTTGTCTTTGGAGAAGGTGTAGT
AAACGATGCCACATCGGTCGTGCTCTTCAACGCCATACAAAGATTCGACCTAACACACATCAATTCAACCATAGTTTTGG
AGTTTGCTGGAAACTTCTTTTCTCTCTTCATCTTAAGCACAGCTCTTGGTGTTGCAGCTGGGTTGCTCAGTGCTTTCACA
ATCAAGAAGCTCTACTTCGGAAAGATCAAGCACTCTACTGATCGTGAAGTTGCACTTATGATGTTAATAGCATACTTGTC
ATATATGTTGGCAGAGCTATTCCACTTAAGCTCTATCTTGACTGTGTTCTTCTGTGGGATTACTATGTCTCACTACACAT
GGCACAATGTTACAGATAAATCAAAGGTCACTACCAAACACACTTTTGCTGCATTGTCGTTTCTAGCTGAGATCTTTATC
TTTCTTTACGTTGGAATGGATGCTCTAGATATCGAAAAATGGGACGTGGTACGCAACAGTCCTGGCCAGTCTATTGGAGT
GAGTGCGATACTCCTTGGCCTTATTCTTCTGGGTCGAGCCGCCTTTGTGTTCCCTCTTTCGTTCTTGTCGAACTTGACAA
AGTCTTCTCCGGATGAGAAAATAGATTGGAAGAAACAAGTAACCATTTGGTGGGCTGGTCTGATGCGTGGTGCCGTGTCG
ATGGCTCTTGCTTATAATCAGTTCACGACTTCAGGACACACCAAGCTTCTTGGAAATGCTATAATGATCACCAGCACCAT
CACTGTTGTTCTTTTCAGTACTGTGGTATTTGGATTGTTAACCAAACCATTAGTCAAACACTTGCAGCCTCCATCAAAGA
AGCCCTCCACACCGATGTCATCTTTCCACGAGCCGCTCCTCAATGGCGATGGCGACAGCAGCTACATCGAAAACCACGAG
CCTCTGCACCGCACCCAGGGCCAATCAGACTACATCCTTGAACAAATCACTCTAAGAATGTTCTTGAGCACTCCTTCCCG
AGCCATTCATCATTACTGGAGGAGATTCGATAACGCGGTTATGCGTCGCATATTTGGAGGCCGTGGCGTTTCAGAGGTAG
TTCCTGGCTCACCTATTGATACTAGTGTTCGGCAGCTGTGGACTGAAGACGTAGAGAACAAGGAACAATACGCTGAGCCT
TGA