Details for Kale Locus Bo5g143540

Position : C5 ( 5`- 44547702 .. 44548519 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143540

Protein [Map View]
MASTENPDPETGKSEPLPASTEPLTPPQAPSSASGFLDCRKIDIIIRVLLFSATLTALIVMVTSDQTEMTQLPRAPSPAP
VSAEFSDSPAFIYFVVALVVAGFYALISTIISISLLLRPEFAAQFSIYISSFDMVALGILASATGTAGGVAYIALKGNEE
IGWNKICNVYDKFCRYIATSLALSLFASLLLLVLSIFSLWKRTTT*

DNA
ATGGCTTCTACTGAAAACCCCGATCCAGAAACCGGCAAATCTGAACCGCTTCCGGCGTCAACTGAGCCACTAACACCACC
ACAAGCACCGTCCTCAGCCTCCGGTTTCCTAGATTGCCGGAAAATAGACATCATAATAAGAGTTCTGCTTTTCTCAGCCA
CACTGACTGCTCTTATAGTAATGGTGACTAGCGACCAGACGGAGATGACTCAGCTCCCTAGAGCTCCATCTCCTGCTCCT
GTCTCCGCCGAGTTCAGTGACTCGCCCGCTTTCATATACTTCGTGGTGGCTCTTGTGGTGGCTGGTTTCTACGCCTTAAT
CTCAACAATTATTTCTATATCTCTACTCTTGCGACCTGAGTTCGCTGCACAGTTCTCCATTTATATATCTTCCTTTGACA
TGGTGGCGCTGGGGATTTTGGCGTCTGCGACGGGAACGGCGGGAGGAGTTGCGTACATAGCGCTGAAAGGAAACGAAGAA
ATTGGATGGAACAAGATTTGTAACGTCTACGACAAGTTTTGTCGTTACATTGCAACGTCGCTTGCCTTATCTCTCTTTGC
TTCTCTTCTGCTTCTAGTGTTATCCATTTTCTCTCTGTGGAAGAGAACAACAACATGA