Details for Kale Locus Bo5g143520

Position : C5 ( 5`- 44529941 .. 44531752 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143520

Protein [Map View]
MERYGRAGEEGSRSDPSLEWTTALQTGVQASVWRAGGESYPERPDEPDCIYYLRTGACGYGSRCRFNHPRDRGAVVGGVR
GGGGGGDGALPERMGQPVCQHFMRTGTCKFGATCKYHHPRQGGGSVAPVSLSYLGYPLRPGEKECSYYLRTGQCKFGLTC
RFNHPVPQQQQQPQPQPQLHTIYPTLQSQPSQQYGLVLARPSLLPGSYLPSHYGPPMVLPPGMVTYPGWNPFQPSLTAMP
SPGTQPSIGPSSVYGMAPLSPSGAAYTGTYQSGGPSSLTISKEEPFPQRPDQPECQYFMRTGDCKFGSSCRYHHPLDAVQ
PKTGVVLFSSIGLPLRPGVAQCTHFAQHGICKFGPACKFDHSMSSSLSYSPSASSLTDMPVAPYPIGSSSLSGASAPVSL
SNEPTTEAVTAVSSPMVSGQEPAETSGDSASVSGSIEAKTSSSS*

DNA
ATGGAGCGGTACGGTCGCGCCGGTGAAGAAGGGTCGCGATCGGATCCATCTCTTGAATGGACCACCGCTCTCCAAACCGG
AGTCCAAGCTTCTGTGTGGCGAGCTGGAGGAGAATCGTACCCGGAGAGACCCGATGAGCCTGATTGTATTTATTACTTGC
GAACCGGTGCTTGCGGGTACGGGTCGAGATGTCGGTTTAATCACCCGCGCGATCGTGGAGCGGTTGTTGGAGGTGTGAGA
GGAGGAGGAGGAGGAGGAGATGGAGCTCTACCGGAGAGGATGGGGCAACCGGTTTGTCAGCATTTTATGAGAACGGGGAC
GTGTAAGTTCGGTGCTACTTGCAAGTATCATCACCCAAGGCAAGGAGGTGGTTCGGTTGCGCCTGTCTCGCTAAGTTATT
TGGGATATCCATTACGCCCGGGAGAGAAAGAGTGTTCTTACTACCTGAGAACCGGTCAGTGTAAATTTGGTTTGACCTGT
AGATTCAACCATCCAGTACCTCAGCAGCAGCAGCAGCCACAGCCTCAACCTCAGCTACACACTATTTATCCAACGCTTCA
GTCTCAACCCTCTCAACAATACGGTTTAGTTTTGGCAAGGCCTTCTCTTTTACCTGGTTCTTATCTCCCAAGTCATTACG
GTCCTCCTATGGTTCTGCCTCCGGGTATGGTTACATACCCTGGTTGGAATCCTTTCCAGCCTTCTTTAACTGCAATGCCT
TCGCCTGGAACTCAACCGTCTATTGGACCGAGCTCTGTTTACGGAATGGCACCGTTATCTCCCTCAGGGGCTGCTTATAC
AGGAACGTACCAATCCGGTGGGCCTTCTTCCTTGACCATCTCAAAAGAAGAGCCGTTTCCTCAGCGACCTGATCAGCCTG
AGTGTCAATACTTTATGAGAACCGGAGACTGTAAATTCGGATCTTCATGCAGATACCATCATCCTCTAGATGCAGTTCAA
CCCAAAACCGGTGTTGTTCTCTTCAGCTCCATTGGCCTTCCACTTCGTCCAGGCGTGGCGCAGTGCACTCACTTCGCGCA
ACACGGAATCTGCAAGTTTGGACCAGCGTGTAAGTTCGATCACTCGATGAGCTCTTCGCTTAGCTACAGCCCGTCTGCTT
CTTCGCTAACGGATATGCCCGTGGCTCCATACCCGATAGGATCGTCTTCACTCAGCGGCGCATCTGCTCCAGTAAGCTTG
AGCAATGAGCCAACCACAGAGGCTGTAACTGCAGTTTCTTCTCCTATGGTCAGTGGTCAAGAGCCAGCGGAGACTAGTGG
AGACTCGGCTAGCGTCAGTGGCAGTATAGAAGCTAAGACTTCTTCTTCAAGTTAA