Details for Kale Locus Bo5g143500

Position : C5 ( 5`- 44512789 .. 44514400 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143500

Protein [Map View]
MASMSLSFSSSLCSSRIPESKRRFHQREPIFARCVLAASKSSPGGGATAATKKRLWKEGEFPGITEPANTRRAPMKNVKK
KLDRRSKANGWACTVTETLSDLIAKKQWLQALEVFEMLREQPFYQPKEGTYMKLLVLLGKSGQPHRAQKVFDEMLEEGLE
PTAELYTALLGAYCRSNLIDSAFSVLERMKSLPQCQPDVYTYSTLLKACVDASLFDLVESLYREMDERLITPNTVTQNIV
LSGYGRVGRFDQMEKVLSDMLVSTECKPDVWTMNIILSVFGNMGKIDMMESWYEKFRNFGIEPETRSFNILIGAYGKKRM
YDKMSSVMEYMRKLEFPWTTSTYNNIIEAFADVGDAKNMEYTFDQMRSEGMKADTKTFCCLINGYANAGLFHKVISSVQL
AAKFEIPENTSFYNAVISACAKADDLIEMERVYTRMKERECVRDSRTFEIMAEAYEKEGMNDKIYYLEQERQKVMDHHAA
ATKEEGMIARGVEIFTIQTVE*

DNA
ATGGCGTCAATGTCTCTCTCGTTTTCTTCTTCGCTATGCTCATCTCGAATCCCCGAATCAAAACGCAGATTCCACCAAAG
AGAACCAATCTTCGCGCGATGCGTTCTCGCCGCTTCTAAATCATCTCCGGGAGGAGGCGCCACCGCCGCGACGAAGAAGA
GGCTCTGGAAGGAAGGAGAGTTCCCCGGAATCACGGAGCCTGCTAACACTCGAAGAGCCCCGATGAAGAACGTGAAGAAG
AAGCTCGACAGGAGGAGCAAAGCCAACGGGTGGGCTTGCACCGTCACCGAAACGTTATCCGATCTCATCGCGAAGAAGCA
GTGGCTGCAAGCTCTCGAGGTGTTCGAGATGCTGAGGGAGCAACCGTTTTATCAGCCAAAGGAAGGAACTTACATGAAGC
TCCTCGTTCTTTTGGGGAAATCAGGACAGCCTCACCGTGCACAGAAGGTGTTCGACGAAATGCTTGAAGAAGGACTTGAA
CCAACTGCTGAGCTCTACACTGCTCTACTCGGTGCTTACTGTCGTAGCAATCTTATAGACTCTGCTTTCTCAGTTCTCGA
ACGGATGAAAAGTTTACCTCAGTGTCAACCTGATGTTTACACTTACAGCACTCTCCTCAAAGCCTGTGTGGACGCTTCTT
TGTTTGATTTGGTTGAGTCTTTGTATAGAGAGATGGATGAGCGTTTGATAACTCCAAACACTGTGACTCAGAACATAGTT
TTAAGCGGGTACGGGAGAGTTGGTAGGTTTGATCAGATGGAGAAAGTTTTATCAGATATGCTGGTGAGTACTGAGTGTAA
GCCCGATGTGTGGACGATGAACATTATCCTCAGCGTGTTTGGGAACATGGGGAAGATAGACATGATGGAGAGCTGGTACG
AGAAGTTCAGGAACTTCGGGATCGAGCCTGAGACTCGGAGTTTCAATATCTTGATCGGTGCGTATGGGAAGAAGAGAATG
TATGATAAGATGTCGTCCGTGATGGAGTACATGAGAAAGCTCGAGTTTCCGTGGACGACGTCGACTTACAACAACATCAT
CGAGGCCTTTGCGGATGTGGGTGATGCGAAGAACATGGAGTATACGTTTGATCAGATGCGTAGCGAAGGTATGAAAGCAG
ATACAAAGACCTTTTGCTGTCTCATTAATGGATATGCCAATGCTGGTCTTTTCCATAAGGTGATAAGTAGTGTTCAGTTA
GCTGCGAAGTTTGAGATACCTGAGAATACTTCTTTTTATAATGCGGTTATATCGGCGTGTGCCAAAGCGGATGATCTTAT
AGAGATGGAGAGAGTGTACACGAGGATGAAGGAGAGGGAATGTGTGAGGGATTCGAGAACGTTTGAGATCATGGCGGAGG
CGTATGAGAAGGAAGGGATGAACGATAAGATATATTACTTGGAACAAGAGAGGCAAAAGGTTATGGATCATCATGCTGCA
GCTACGAAAGAGGAGGGGATGATTGCAAGGGGAGTGGAGATCTTTACCATTCAAACAGTAGAGTAA