Details for Kale Locus Bo5g143480

Position : C5 ( 5`- 44457128 .. 44457949 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143480

Protein [Map View]
MASVHSTLTYWLVNHPNIVNFTWTEGETLGSTVLFVSVVVSVYLSATLLLRSSIDSLPSLGPTILKPLTALHSLILCLLS
LIMAIGCTLSITTDPTASLFNAICFPLDVKPSGPLFFWAQVFYLSKILEFGDTILIILGKSIQRLSFLHVYHHATVVVMC
FLWLRTRQSMFPIALVTNSTVHVIMYGYYFLCAVGSRPRWKRLVTDCQIVQFVFSFGLSGWMLREHLFGSGCSGIWGWCF
NAAFNASLLALFFNFHSKNYAKKTSRQGDCKSD*

DNA
ATGGCATCAGTTCACTCTACCCTCACATACTGGCTCGTGAACCACCCCAACATCGTCAATTTCACGTGGACCGAAGGTGA
AACTCTTGGCTCCACCGTCCTCTTCGTGTCCGTTGTAGTCTCAGTCTACCTCTCCGCCACGTTACTCCTCCGATCCTCCA
TCGATTCACTCCCTTCTCTCGGTCCCACAATTCTCAAACCACTCACAGCCCTCCACAGCCTCATCCTCTGCCTTCTCTCT
TTGATCATGGCCATTGGTTGCACTCTCTCCATCACCACAGATCCGACAGCAAGTTTGTTCAACGCGATCTGTTTCCCATT
GGACGTGAAACCTAGCGGACCGCTTTTCTTCTGGGCTCAAGTCTTCTATCTCTCGAAGATACTCGAGTTCGGAGACACAA
TCCTCATCATACTCGGCAAATCAATCCAACGGCTGTCCTTCCTCCACGTGTACCACCACGCGACGGTTGTGGTCATGTGC
TTCCTCTGGCTGAGGACCCGCCAGTCGATGTTTCCCATTGCGCTCGTGACTAATTCGACGGTTCATGTAATCATGTACGG
CTATTACTTTCTTTGCGCTGTTGGGTCGAGGCCGAGGTGGAAGAGGTTAGTGACGGATTGTCAGATTGTGCAGTTTGTTT
TCAGCTTCGGGTTGTCCGGTTGGATGCTCCGAGAGCATTTGTTCGGGTCGGGTTGCTCTGGGATTTGGGGGTGGTGTTTC
AACGCTGCGTTTAATGCTTCTCTTTTGGCTTTATTCTTTAACTTCCATTCCAAGAACTATGCTAAAAAGACTAGCAGACA
GGGAGACTGCAAAAGCGATTAA