Details for Kale Locus Bo5g143470

Position : C5 ( 5`- 44454166 .. 44456461 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143470

Protein [Map View]
MIFPKSLIEDLHKWGCMKQTGVSLRYMMEFGSTPTEKNLLISAQFLHKELPIRVARRAIELETLPYGLSEKPAVLKVRDW
YLESFRDMRAFPEIKDTADEKDFTQMIKAVKVRHNNVVPMMALGVNQLKKGVHFYENLDEIHQFLDRFYLSRIGVRNLIG
QHVELHNPNPPRHCVGYIHTKMSPMEVARNATEDARSICYREYGSAPEINIYGDPSFTFPYVPTHLHLMVYELVKNSLRA
VQERYVDSDRVAPPVRIIVADGIEDVTIKVSDEGGGIPRSGLPKIFTYLYSTATNPLEEEMEFGTADVPVIMAGYGYGLP
ISRLYARYFGGDLQIISMEGYGTDAYLHLSRLGDSQEPLP*

DNA
ATGATATTTCCTAAGAGCTTGATCGAGGATCTTCACAAATGGGGATGCATGAAGCAGACGGGCGTTAGCCTCAGGTACAT
GATGGAGTTCGGTTCCACCCCCACCGAGAAGAACCTTTTGATCTCCGCGCAGTTTCTCCACAAGGAGCTTCCCATTCGCG
TCGCGAGGAGAGCGATCGAACTCGAGACGCTGCCTTACGGTCTCTCCGAGAAACCTGCCGTCTTGAAGGTAAGGGATTGG
TATCTGGAATCATTCAGGGACATGAGAGCGTTTCCCGAGATCAAAGACACGGCGGACGAGAAGGACTTCACTCAGATGAT
CAAGGCCGTCAAAGTTAGGCACAACAATGTGGTTCCCATGATGGCTCTCGGTGTTAACCAGCTCAAGAAAGGAGTCCATT
TCTACGAGAATCTTGACGAGATTCATCAGTTTCTTGATCGCTTCTACTTGTCTCGTATAGGCGTCCGTAACCTTATCGGG
CAGCATGTTGAGTTGCATAATCCAAATCCGCCACGTCATTGTGTGGGTTACATACACACTAAGATGTCTCCTATGGAGGT
AGCGAGGAACGCTACCGAAGATGCACGGTCTATTTGTTATAGAGAGTATGGTTCTGCTCCGGAAATCAACATATATGGTG
ATCCAAGTTTCACCTTTCCGTATGTGCCAACCCATTTGCATCTTATGGTGTATGAGCTAGTCAAGAACTCTCTACGTGCT
GTCCAAGAGCGGTATGTTGATTCCGATAGAGTTGCACCACCAGTCCGCATTATAGTTGCTGATGGAATCGAAGATGTTAC
CATAAAGGTCTCAGATGAAGGTGGAGGTATACCGAGAAGCGGTCTCCCCAAGATATTCACCTATCTTTACAGCACGGCAA
CGAACCCGCTTGAAGAGGAAATGGAATTTGGAACAGCTGATGTTCCCGTGATTATGGCTGGTTATGGTTATGGTCTGCCA
ATTAGTCGCTTGTATGCTCGTTATTTTGGTGGAGATTTGCAGATCATATCCATGGAAGGATACGGGACTGATGCTTACTT
GCACTTGTCGCGCCTTGGAGATTCACAAGAGCCTTTGCCCTGA