Details for Kale Locus Bo5g143460

Position : C5 ( 5`- 44429539 .. 44431775 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143460

Protein [Map View]
SSFLSKKYQTLYFSLSLSLKPQRKKVVSLKFFFAEVSLFFGYFLCASMDEKGRNLKNNNMEDEMDLKRGPWTAEEDFKLM
NYIATHGEGRWNSLSRCAGLQRTGKSCRLRWLNYLRPDVRRGNITLEEQLLILELHSRWGNRWSKIAQYLPGRTDNEIKN
YWRTRVQKHAKQLKCDVNSQQFKDTMKYLWMPRLVERIQSASAAATVATTTNTTTTTVSAATSSSNTTSNNQFMTYDYNN
NSMGQQFGVVNNDYITPENSNVAVSPMSDLTEYYSAPNTYPEYYSGQVGNSYYPDQDLVVPQILPDNYLDYSGLLDEDLA
VMQEQSNLNWFEDINGATSSSDSLWNIGESDEDLWFLQDQEQFNNNGNF*

DNA
TCATCATTTCTCTCCAAAAAATATCAAACTCTCTATTTCTCTCTCTCCCTCTCCCTAAAACCACAAAGAAAAAAAGTAGT
AAGTCTGAAATTTTTTTTTGCTGAGGTTTCTCTTTTCTTTGGGTATTTTCTGTGTGCATCAATGGATGAGAAAGGAAGAA
ACTTGAAGAACAACAACATGGAAGACGAAATGGACCTGAAGAGAGGTCCATGGACCGCTGAAGAAGATTTTAAGCTCATG
AATTACATTGCTACTCATGGAGAAGGTCGATGGAACTCTCTTTCTCGTTGTGCAGGACTCCAACGCACCGGTAAAAGCTG
TAGGTTACGGTGGTTAAACTATCTCCGCCCTGATGTCCGCCGTGGAAACATTACCCTCGAAGAACAACTCTTGATCCTCG
AACTTCATTCCCGTTGGGGCAATCGATGGTCAAAAATCGCACAATACCTACCGGGAAGAACAGACAATGAGATCAAAAAC
TACTGGAGAACCCGAGTTCAAAAACATGCAAAGCAGCTTAAATGCGACGTGAACAGTCAGCAATTCAAAGACACAATGAA
GTATTTGTGGATGCCTAGGCTGGTCGAGAGGATCCAATCTGCCTCGGCCGCAGCCACCGTAGCCACAACCACCAACACCA
CTACCACGACAGTATCAGCCGCTACGTCATCTAGCAACACAACCTCTAACAATCAATTCATGACGTATGATTACAACAAC
AACAGCATGGGACAACAATTTGGTGTAGTGAACAACGATTATATCACGCCCGAAAACTCTAACGTGGCAGTGTCTCCGAT
GTCAGATTTGACGGAGTACTACAGCGCTCCAAACACGTACCCGGAATACTATTCGGGTCAAGTGGGGAATAGCTATTATC
CGGATCAGGACTTGGTGGTTCCGCAAATATTACCGGATAATTATTTGGATTATTCTGGATTATTAGACGAAGATTTGGCG
GTTATGCAGGAGCAGAGTAACCTTAACTGGTTTGAAGATATTAATGGAGCTACTTCTTCTTCAGACAGTTTATGGAACAT
TGGAGAAAGTGATGAAGACTTATGGTTTTTACAGGATCAAGAACAGTTCAACAATAATGGCAACTTCTGA