Details for Kale Locus Bo5g143430

Position : C5 ( 5`- 44400807 .. 44403683 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143430

Protein [Map View]
MSILTLLVKIAGLLGTITVGANAVSYSRFRRRNLRNFRSPIDESKEVLADFTSHEYNESKFFFGLATAPAHAEDDLDDAW
IRFAKETPCSAEDEEDKKAKRKKKVKLAVGAITKGLAKNTQGKEDNTVADSTPTKNVAAWHNTPHAEVRLKFWSDPDQEV
KLAKATGVTVFRMGVDWCRIMPKEPTQGIKEAVDYEAIEHYKWILNRVRSNGMKVMLTLFHHSLPPWAADYGGWKMEKTV
DYFMDFTRLVVDSMFDLVDSWITFNEPHVFAMLTYMAGTWPGNNPDFLEMATSTLPMGVFHRVMHWMAVAHSKAYDYIHG
KTSLEKPLVGVAHHVSFMRPYGLFDVGSVTFSNSLTMFSYIDSICEKLDFIGINYYGQEAVCGVGLKLVETDEYSESGRG
VYPDGLYRVLLMFHQRYKHLNVPFIVTENGVSDETDVIRRPYMIEHLLALYAAMLKGVPVLGYIFWTISDNWEWADGYGP
KFGLVAVDRANNLARTVRPSYHLFTKIVKSGKITRNDRSLAWEELQKAAKAGKVRPFYRAVDNHGLMYADGLDKPQGRQF
VDRDWRFGHYQVDGLQDPLSRLARALLIWPVITKKKIRKVKVKHTDESGLALQPA*

DNA
ATGAGCATACTCACACTGCTTGTTAAAATCGCCGGACTTCTTGGCACGATCACCGTCGGCGCCAACGCAGTCTCCTACTC
TCGTTTCCGTCGCCGGAACCTCCGGAACTTTCGCTCTCCAATCGACGAATCCAAAGAAGTCCTCGCCGATTTCACCTCCC
ACGAATACAATGAGAGCAAGTTCTTCTTTGGATTAGCTACTGCACCTGCTCACGCGGAGGACGATCTCGACGATGCATGG
ATCCGGTTTGCAAAGGAAACACCGTGTTCAGCGGAAGATGAAGAGGACAAGAAAGCAAAGAGGAAGAAGAAGGTTAAGCT
TGCTGTGGGAGCTATAACGAAAGGGTTGGCCAAGAACACTCAGGGAAAAGAAGATAACACTGTTGCCGACAGTACACCCA
CTAAGAATGTAGCCGCGTGGCATAACACACCTCACGCAGAAGTCAGACTTAAGTTTTGGTCGGATCCTGACCAAGAAGTG
AAGCTAGCTAAAGCTACTGGCGTTACTGTCTTCAGGATGGGAGTAGATTGGTGTAGGATCATGCCAAAAGAGCCTACCCA
AGGGATTAAGGAAGCAGTTGACTATGAGGCCATTGAACACTATAAATGGATACTCAACAGAGTTCGTTCAAACGGGATGA
AGGTGATGCTAACGCTGTTTCATCATTCATTACCACCATGGGCTGCTGATTACGGTGGATGGAAAATGGAGAAGACCGTC
GACTACTTTATGGACTTCACCAGGCTTGTTGTGGATTCCATGTTCGATTTGGTAGATTCTTGGATTACATTCAATGAACC
CCATGTCTTCGCCATGCTTACTTACATGGCCGGAACTTGGCCCGGTAACAACCCTGATTTTTTGGAGATGGCTACATCTA
CTCTACCAATGGGTGTATTCCATCGAGTCATGCATTGGATGGCTGTTGCTCACTCAAAGGCCTATGACTACATCCACGGG
AAAACCTCCTTGGAAAAACCTTTGGTAGGGGTTGCGCACCACGTGTCCTTTATGCGACCGTATGGCCTCTTTGATGTTGG
GTCCGTTACTTTTAGTAACTCCCTCACTATGTTTTCATATATTGATAGCATTTGTGAGAAACTTGATTTCATTGGCATCA
ACTACTACGGACAGGAAGCAGTGTGTGGTGTTGGACTAAAGCTTGTAGAGACTGATGAATACAGTGAATCTGGAAGAGGG
GTATACCCTGATGGTCTCTACCGCGTGTTGTTGATGTTCCACCAGAGATACAAACACCTGAACGTTCCTTTCATCGTCAC
AGAGAACGGTGTTTCTGATGAAACGGATGTGATTCGTCGGCCTTACATGATCGAGCATCTTCTTGCCCTTTATGCTGCAA
TGCTAAAGGGTGTTCCGGTGCTCGGTTACATATTCTGGACTATTTCAGACAACTGGGAATGGGCTGATGGGTATGGTCCA
AAATTTGGACTTGTTGCGGTTGACCGAGCTAATAATCTTGCTCGGACCGTTCGGCCATCGTACCATCTCTTTACCAAGAT
AGTGAAAAGCGGAAAAATCACTCGTAATGATCGGTCTCTTGCATGGGAAGAACTCCAAAAAGCTGCGAAAGCAGGAAAGG
TACGACCGTTCTACCGTGCAGTTGATAATCATGGTCTGATGTACGCAGATGGTCTGGACAAGCCTCAAGGGAGACAGTTT
GTTGACCGTGACTGGCGGTTTGGTCACTACCAAGTGGATGGTCTTCAAGACCCGCTGAGTCGCTTGGCTCGAGCTCTTCT
CATATGGCCGGTCATCACGAAAAAGAAGATAAGAAAAGTCAAGGTTAAGCACACCGATGAGTCAGGGCTTGCTCTACAGC
CCGCGTAG