Details for Kale Locus Bo5g143410

Position : C5 ( 5`- 44384531 .. 44387118 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143410

Protein [Map View]
MSDLPPYPPLDPTTYDLIIVGTGVPSSILAAAASSSGTSVLHLDPNPFYGSHFASLSLPDLTSFLRSNSLSPPPPPPSDN
PDFLSVDLATRSLYSSVEIATFDSSILDERHSRKLNVDLCGPRVLFCADESINLMLRSGSNNYVEFKSVDASFVGDSSGE
LRSVPDSRGAIFKDRSLALAEKNQLMKFFKLVQAHLAAAAASSTESDEGAVKITEEDMETPFVEFLAKMLLPPKIKWIIL
YGIAMVDYDQDNVEACGDLLKTREGIARLALYITSIGRFSNAVGALIYPIYGQGELPQAFCRRAAVKGCIYVLRMPITAL
LLDKETGGYKGVRLATGQEIFSQKLILDPCITLGSESMSSLTDQQKETLRVLVPKSISSEAKIARGICIIRGSVKAGISN
ALVVYPPKSLFPEQLVAIRVLQLGSGLAVCPADMHVLYFSTVCDNDDQGKAALLSAMSTLIRPQVPENSESESVVENDNV
EAKPVVLWRALYVQELVKGEFGGSISSASSPDGNLNYNELVESAVKLYEHVMGSEELFKEETSPDNATEEENDGGVEIEA
M*

DNA
ATGAGCGACCTCCCTCCATATCCGCCGCTCGATCCCACCACCTACGACCTCATCATCGTCGGCACCGGGGTTCCCTCATC
CATCCTCGCCGCCGCCGCTTCGTCCTCCGGCACCTCCGTTCTCCACCTCGATCCCAACCCCTTCTACGGCTCCCACTTCG
CATCCCTCTCCCTCCCCGATCTCACCTCCTTCCTCCGCTCAAACTCCCTCTCCCCTCCCCCTCCTCCGCCGTCAGACAAT
CCCGACTTCCTCTCCGTCGATCTCGCCACCCGATCCTTGTACTCCTCCGTCGAGATCGCGACCTTCGACTCCTCGATCCT
CGACGAACGCCATTCTCGAAAGCTCAACGTCGACCTGTGCGGTCCTAGGGTTCTCTTCTGCGCGGACGAGTCGATCAACC
TAATGCTGAGATCGGGATCCAACAACTACGTGGAGTTCAAGAGCGTCGACGCGAGCTTCGTCGGGGACTCGAGCGGAGAG
CTGAGGAGCGTCCCCGATTCGAGAGGCGCGATATTCAAGGATAGGAGTTTGGCTCTGGCGGAGAAGAATCAGTTGATGAA
GTTCTTCAAGCTTGTTCAGGCTCACTTGGCTGCTGCTGCTGCTTCCTCCACGGAGAGCGATGAGGGGGCGGTTAAGATTA
CGGAGGAAGATATGGAGACTCCGTTTGTTGAGTTCTTGGCTAAGATGCTTTTGCCTCCCAAAATCAAATGGATCATCTTG
TATGGCATTGCGATGGTAGACTATGATCAAGACAATGTGGAAGCTTGTGGAGATTTACTCAAGACTAGAGAGGGGATAGC
TCGATTGGCTTTGTACATTACATCTATTGGCAGATTTTCAAACGCAGTTGGGGCGTTGATATATCCTATTTATGGACAAG
GAGAGCTTCCACAAGCCTTTTGCCGTAGAGCCGCTGTGAAAGGATGCATCTATGTTCTCCGGATGCCTATTACTGCTCTG
CTTTTAGACAAGGAAACTGGGGGTTACAAAGGGGTTAGACTAGCTACGGGTCAAGAGATATTCAGCCAAAAGTTGATTCT
TGACCCATGTATTACTCTTGGATCGGAGTCAATGTCGTCATTGACTGATCAGCAGAAAGAAACTCTTCGTGTTCTTGTGC
CAAAGTCGATAAGCAGCGAGGCGAAAATAGCTAGAGGAATTTGTATCATTAGAGGTTCTGTGAAAGCTGGTATATCAAAC
GCTCTTGTCGTATATCCACCCAAATCTTTGTTTCCTGAACAGTTAGTTGCGATTCGGGTTCTGCAGCTTGGTAGTGGTTT
AGCAGTTTGTCCAGCTGACATGCATGTTTTATATTTTTCAACTGTGTGTGACAACGATGATCAAGGGAAAGCTGCACTGT
TATCAGCCATGAGTACTCTCATTAGACCGCAGGTTCCTGAGAATAGTGAAAGCGAATCAGTAGTCGAGAATGACAATGTT
GAAGCAAAACCTGTTGTACTCTGGAGAGCACTGTACGTGCAAGAGCTGGTCAAGGGTGAATTTGGAGGTAGTATCAGCTC
CGCGTCTAGTCCAGATGGAAATTTGAACTACAATGAGCTTGTGGAATCAGCCGTGAAGCTATATGAGCATGTTATGGGGA
GTGAAGAATTGTTTAAAGAAGAAACTTCGCCGGACAACGCAACAGAGGAGGAAAACGATGGTGGTGTTGAAATAGAAGCT
ATGTGA