Details for Kale Locus Bo5g143400

Position : C5 ( 5`- 44380522 .. 44383727 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143400

Protein [Map View]
MAISSSVTPGLMSVVLGIVPVIVAWLYAEYLHYAKHSVSAKAHSDVNLVEIVKDFVKEDDKALLIEDGGGLQSPSTKTKG
SSVHSPLIRFVLLDESFLVENRLALRAIIEFAVLMGYFYICDRTDVFSSSKKSYNRDLFLFLYFLLIIVSAITSFTIHND
KSALNGKSIMYLNRHQTEEWKGWMQVLFLMYHYFAAAEYYNAIRVFIACYVWMTGFGNFSYYYIRKDFSLARFAQMMWRL
NFLVIFSCIVLNNSYMLYYICPMHTLFTLMVYGALGIMNKYNENGSVIAAKIVACFVVVIIVWEIPGVFEWVWSPFTFLL
GYNDPAKPQLPLLHEWHFRSGLDRYIWIIGMLYAYYHPTVESWMDKLEEAEIKIRMAIKTTVALIAITVGYFWFEYIYKL
DKYTYNKYHPYTSWIPITVYICLRNITQSFRGYSLTLLAWLGKITLETYISQFHIWLRSGVPDGQPKLLLSLIPEYPLLN
FMLTTSIYVAVSHRLFELTNTLKTAFIPTKDDKRLVYNTISAIIICTCLYFFSFVIVQIPQKLV*

DNA
ATGGCGATATCAAGCTCCGTTACGCCTGGGCTAATGTCGGTGGTGCTCGGGATCGTGCCTGTGATCGTCGCGTGGCTCTA
CGCCGAGTATCTTCACTATGCGAAACACTCAGTCTCCGCCAAAGCGCACTCTGATGTCAACTTGGTGGAAATTGTGAAAG
ATTTTGTTAAAGAAGACGATAAAGCTCTTTTAATAGAAGATGGAGGTGGTCTTCAGTCACCTTCTACCAAAACCAAGGGC
TCCTCCGTACATTCTCCTCTCATCAGGTTTGTGCTCTTGGATGAGTCCTTCTTGGTTGAGAACAGGCTGGCGTTGAGAGC
AATAATCGAGTTTGCAGTGCTTATGGGATACTTTTATATTTGTGACCGTACTGATGTCTTCAGTTCATCCAAGAAGAGTT
ACAACAGGGATCTCTTTCTGTTCCTTTACTTCCTTCTCATCATCGTTTCGGCGATAACTTCATTCACGATACATAATGAT
AAATCAGCATTAAACGGAAAATCCATCATGTACTTGAATAGGCATCAAACCGAGGAGTGGAAAGGCTGGATGCAGGTCCT
CTTTTTGATGTACCACTACTTTGCTGCTGCGGAGTATTACAATGCTATCCGTGTGTTCATTGCTTGCTATGTGTGGATGA
CTGGATTTGGGAACTTTTCTTATTATTACATTCGCAAGGACTTTAGCCTTGCAAGGTTTGCACAGATGATGTGGCGGCTG
AATTTCCTGGTCATATTCTCCTGCATCGTCCTCAACAACAGTTACATGCTATACTACATATGCCCCATGCACACTCTGTT
TACTCTGATGGTCTACGGAGCACTTGGTATTATGAACAAATATAATGAGAATGGTTCAGTCATAGCTGCCAAAATTGTTG
CCTGCTTCGTTGTTGTGATCATCGTTTGGGAGATTCCCGGCGTTTTTGAATGGGTTTGGAGTCCATTTACGTTCCTATTG
GGTTACAATGACCCTGCGAAACCGCAGCTTCCTCTCTTGCATGAGTGGCATTTTCGCTCGGGCCTTGACCGGTACATATG
GATAATCGGGATGCTCTACGCATACTACCACCCAACTGTTGAGAGTTGGATGGATAAACTGGAGGAAGCTGAGATAAAGA
TCAGGATGGCTATCAAAACAACTGTGGCACTGATAGCAATAACGGTGGGATATTTTTGGTTCGAGTACATATACAAGCTG
GATAAGTATACTTACAACAAATATCATCCTTACACCTCTTGGATTCCAATAACTGTTTATATCTGTCTCCGGAACATCAC
CCAGTCTTTCCGCGGCTACAGTTTGACCCTCTTGGCGTGGCTTGGGAAGATAACACTGGAGACATATATCTCACAGTTTC
ATATATGGCTCAGATCTGGAGTTCCTGATGGTCAGCCCAAGTTGCTACTCTCTCTAATCCCGGAATACCCATTGTTGAAC
TTCATGCTCACAACTTCCATTTACGTCGCTGTCTCTCATAGGCTCTTTGAGCTTACAAACACATTGAAAACAGCCTTCAT
ACCAACCAAAGACGACAAGCGCCTTGTCTACAACACCATCTCAGCAATCATAATCTGCACTTGCCTCTACTTCTTCTCGT
TTGTTATCGTCCAAATCCCCCAAAAACTGGTGTGA