Details for Kale Locus Bo5g143390

Position : C5 ( 5`- 44372171 .. 44374498 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143390

Protein [Map View]
MAELEQECSVSLRQLMVNEGLIPSPEDDKKRRSVIHMLQRIVVRWIKIVAWKRRLPQHHINATNATIIPYGSYGLGVHGS
ESDIDALCIGPFFATITEDFFIDLHDLLKSRAEVSEVHCVKDAKVPLIRFKFDGILVDLPYAQLRVLSIPNNVDVLNPFF
LRDIDDTSWRSLSGVRANQCILQIVPSVELFQSLLRCVKLWAKRRGVYGNLNGFLGGVHMAILAAFVCGYNPNATLSSLV
ASFFSTFAYWQWPTPVVLLRDAYAATGSPPGLMPIQLPCGGRQYCNSNVTRSTYCKIMSEFHRGHHLTKGYLKHGFNWNS
LFEPYPYATTYAWFVKIHLSASNEEDLSDWVGWVKSRFRSLLIKIEEVFGLCDPNPTEHLEACEKQPNIVYYWGLHLRTV
NVSDIESVETDFLKNVNNSGSFQGSVGGIQLSVVQTSQLPKNVECDTSNRNKRVTRTCWRVRDDNHCKDKPVYSRHLPGY
VVGYEKINDRDAESTDVKC*

DNA
ATGGCTGAATTAGAACAAGAATGCTCTGTTTCGCTTCGTCAGCTTATGGTGAATGAAGGACTCATTCCATCTCCTGAAGA
TGACAAGAAACGAAGAAGCGTTATTCATATGCTACAAAGGATAGTAGTGAGATGGATTAAGATCGTTGCTTGGAAACGAC
GTCTTCCTCAACATCATATCAACGCAACCAACGCCACCATAATCCCTTATGGATCCTATGGTCTTGGGGTTCATGGTTCT
GAATCAGACATTGACGCTTTGTGCATTGGTCCTTTCTTCGCCACTATAACCGAGGATTTTTTCATCGACTTGCATGATCT
GTTAAAAAGTAGAGCCGAAGTTTCAGAGGTTCACTGTGTTAAAGATGCTAAAGTCCCTCTCATCCGCTTCAAATTTGATG
GCATCTTGGTTGATCTTCCATACGCTCAGCTTCGAGTCTTATCAATCCCAAACAATGTAGATGTGCTGAACCCTTTCTTC
TTGAGAGACATTGATGACACAAGCTGGAGAAGCTTGTCTGGAGTTCGCGCAAATCAATGCATCCTTCAGATAGTGCCTTC
CGTTGAGTTGTTTCAATCATTGCTGCGGTGTGTGAAACTATGGGCAAAGAGGCGTGGTGTATACGGTAACTTGAATGGGT
TCCTTGGAGGAGTTCATATGGCTATCCTTGCAGCGTTTGTCTGCGGATATAACCCCAACGCTACGTTGAGTTCCCTTGTG
GCGAGTTTCTTCAGCACGTTTGCTTATTGGCAGTGGCCTACACCAGTGGTGCTGCTGAGGGATGCTTACGCAGCTACTGG
CTCTCCTCCAGGGCTAATGCCTATCCAGTTGCCTTGCGGTGGACGTCAGTACTGCAACTCCAACGTAACGAGGAGCACGT
ATTGCAAGATCATGTCAGAGTTTCACCGAGGGCATCATTTGACTAAGGGTTACTTGAAACATGGCTTTAACTGGAACAGT
TTGTTTGAGCCTTATCCGTATGCAACCACGTACGCTTGGTTCGTCAAGATACACCTCTCTGCTTCTAATGAGGAAGATCT
GAGTGATTGGGTTGGTTGGGTTAAGTCACGTTTCCGCTCTCTACTGATCAAAATAGAGGAAGTCTTTGGACTTTGTGATC
CAAACCCAACAGAGCATTTAGAAGCCTGTGAGAAACAGCCAAACATTGTATACTACTGGGGGTTACATCTCAGAACCGTA
AATGTTTCAGACATTGAATCCGTGGAGACAGACTTTCTGAAGAATGTCAACAACAGCGGAAGCTTCCAAGGATCAGTTGG
TGGAATCCAGTTGTCAGTTGTGCAAACGTCTCAGCTTCCTAAGAATGTTGAGTGTGATACAAGTAACAGAAACAAGAGGG
TGACAAGGACGTGTTGGAGAGTCCGGGATGATAACCACTGCAAGGATAAACCGGTTTACTCAAGGCATTTGCCTGGTTAT
GTGGTTGGGTATGAGAAGATTAATGACAGAGACGCTGAGAGTACTGATGTTAAGTGTTAG