Details for Kale Locus Bo5g143380

Position : C5 ( 5`- 44369111 .. 44371789 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143380

Protein [Map View]
MAKQEEVTVPIFTSLDPVYGEGSQLQEANSRFDALKSKFNQAFGASPQLFARSPGRVNLIGEHIDYEGYSVLPMAIRQDT
IIAIRKREGQNELRIANVNEKYSMCTYPADPLQEIDLKNHKWGHYFICAYKGFHEFAKSKGVNVDSPVGLDVVVDGIVPT
GSGLSSSAAFVCSSTIAIMAVFGESFEKKELAQLTCECEQHIGTQSGGMDQAISIMAKTGFAELIDFNPVRATDVKLPDG
GSFVIAHSLAESQKAVTAATNYNNRVVECRLASIILGIKLGMEPKEAISKVKTLSDVEGLCVSFAGDRGSSDPVLAVKEY
LKEEPYTAEEIERIVEEKLPSILNNDPTSLAVLNAATHFKLHQRAAHVYSEARRVHGFKDTVYSNLSDEEKLKKLGDLMN
DSHYSCSVLYECSCPELEELVKVSRENGALGARLTGAGWGGCTVALVKESGVSQFIAAVKEKYYKKRIEKGVVKEEDMEL
YLFASKPSSGAAIFNF*

DNA
ATGGCGAAACAAGAAGAAGTCACGGTCCCGATCTTCACCTCCCTTGATCCTGTCTACGGCGAAGGATCTCAGCTCCAAGA
AGCTAACTCACGATTCGACGCTTTGAAATCCAAATTCAACCAAGCCTTCGGTGCTTCTCCCCAGCTCTTCGCTCGTTCTC
CCGGAAGAGTGAATCTGATCGGAGAGCACATTGACTATGAGGGATACTCAGTGCTCCCAATGGCTATTCGTCAGGACACC
ATTATTGCTATCAGGAAACGTGAGGGTCAGAATGAGTTGAGGATTGCAAACGTTAATGAGAAGTACTCCATGTGTACTTA
TCCTGCTGATCCTCTCCAGGAGATTGACTTGAAGAATCACAAGTGGGGTCATTACTTCATCTGCGCGTACAAAGGGTTCC
ATGAGTTTGCAAAGTCAAAAGGGGTGAATGTTGATTCACCTGTTGGACTTGATGTGGTTGTTGATGGCATTGTTCCTACA
GGGTCTGGGCTGTCAAGTTCTGCTGCCTTTGTTTGCTCATCAACAATTGCTATTATGGCTGTCTTTGGTGAGAGCTTTGA
AAAGAAAGAACTTGCACAGCTAACATGTGAATGTGAACAACACATAGGAACACAATCTGGTGGAATGGACCAGGCAATCT
CTATCATGGCTAAAACTGGTTTTGCTGAGCTCATCGACTTCAACCCGGTCCGTGCCACCGACGTGAAACTCCCTGATGGT
GGGAGTTTTGTGATCGCACACTCTCTTGCAGAGTCTCAGAAGGCGGTCACAGCTGCTACTAATTACAATAACAGGGTCGT
TGAGTGTCGACTTGCTTCGATCATACTTGGCATTAAGCTTGGAATGGAACCTAAAGAAGCAATATCAAAAGTTAAGACTC
TCTCTGACGTGGAGGGTTTATGTGTGTCGTTTGCTGGTGACCGTGGCTCCTCTGATCCTGTTCTAGCTGTTAAAGAATAT
CTGAAAGAAGAACCATACACGGCCGAGGAGATTGAGAGAATCGTCGAGGAGAAGTTACCATCAATCTTGAACAACGATCC
TACATCTTTAGCTGTACTTAATGCTGCAACGCATTTCAAATTGCATCAGAGAGCTGCACATGTTTACTCGGAAGCACGGA
GAGTTCATGGTTTCAAGGACACTGTCTATTCAAACTTAAGTGACGAAGAGAAGTTGAAGAAGCTTGGTGATCTCATGAAC
GACAGCCATTACAGCTGTAGTGTGCTATACGAGTGCAGTTGCCCGGAGCTAGAAGAACTAGTTAAAGTTTCCAGGGAGAA
TGGAGCACTTGGAGCAAGACTGACCGGAGCTGGGTGGGGCGGTTGCACTGTTGCCTTGGTTAAAGAATCTGGCGTCTCTC
AGTTCATCGCTGCGGTTAAGGAGAAGTACTACAAGAAGAGGATAGAGAAAGGAGTGGTGAAGGAAGAAGACATGGAGCTT
TACCTTTTTGCCTCCAAGCCTTCAAGTGGTGCTGCCATCTTCAACTTCTGA