Details for Kale Locus Bo5g143360

Position : C5 ( 5`- 44351701 .. 44352386 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143360

Protein [Map View]
MKEIQIPRKNSTRSSDTATKRIIKDPELKNRKFAEKRQSATVGSTNDPSDFDPIYFAISDHEAESFLQGSSVDLLPTPEI
CDESPVSSVANKAFHVIDAAIAAGLPASVQSLRAEISDLKKTICSVESSDESKRVDGAVTLKFRVVVLVFVLWALLAAVV
VEVSSGEEVAYSGPLPT*

DNA
ATGAAGGAAATTCAAATTCCCAGGAAAAACTCTACGCGCTCATCTGATACCGCAACGAAGAGGATCATCAAGGATCCTGA
GCTGAAGAATCGAAAGTTTGCGGAGAAGAGACAGAGCGCAACCGTCGGAAGCACGAACGATCCATCGGATTTTGATCCGA
TCTATTTCGCGATCTCCGATCACGAAGCCGAGAGTTTTCTGCAAGGATCGAGTGTAGACCTCTTACCAACGCCAGAGATT
TGCGACGAATCTCCAGTTTCATCCGTTGCTAACAAGGCTTTTCACGTCATCGACGCTGCGATTGCTGCGGGCTTGCCTGC
TTCTGTGCAGTCCTTGCGCGCCGAGATCAGCGACCTGAAGAAAACGATCTGTTCAGTTGAGAGTTCTGATGAAAGTAAAC
GCGTCGATGGAGCTGTTACTCTCAAATTCCGCGTTGTGGTTTTGGTTTTCGTCCTTTGGGCTCTCTTAGCTGCGGTTGTG
GTCGAAGTCAGCTCAGGAGAGGAGGTTGCTTACTCTGGACCACTTCCAACTTGA