Details for Kale Locus Bo5g143310

Position : C5 ( 5`- 44322812 .. 44325998 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143310

Protein [Map View]
MAFWWPLIVLAFAYAICRFLLMLIPPNVPSIDVDASDVLAHGKETEENSFIYIPPRGRSQQSDKKVQCYEPATMKYLGYF
PALSTSEVKERVALSRKAQKTWAQSSFKVRRQFLRILLKYIIEHQELICEVSSRDTGKTMVDASLGEIMTTCEKITWLLS
EGERWLKPEYRSSGRAMLHKVSRVEFHPLGVIGAIVPWNYPFHNIFNPMLAAVFSGNGIVIKVSEHASWSGCFYFRIIQA
ALAAVGAPENLVDVITGFAETGEALVSSVDKMIFVGSTAVGKMIMRNAAETLTPVTLELGGKDAFIICEDADVSHVAQVA
VRGTLQSSGQNCAGAERFYVHKDIYTAFITQVTKIVKSVSAGPPLTGRYDMGAICLQEHSETLQSLVNDALDKGAEIAVR
GSFGHLGEDAVDQYFPPTVLINVNHTMKIMKEEAFGPIMPIMQFSTDEEVIKLANDSRYALGCAVFSGSQRRAKQIASQI
QCGVAAINDFASNYMCQSLPFGGVKDSGFGRFAGIEGLRACCLVKSVVEDRFWPLIKTKIPKPIQYPVAENAFEFQEALV
ETLYGLNIWDRLRSLIDVLKFLTDQSSHVSRTRKSH*

DNA
ATGGCGTTCTGGTGGCCGCTGATCGTTCTCGCCTTCGCTTACGCGATCTGCAGATTCCTTCTTATGCTCATTCCTCCCAA
CGTTCCCTCCATTGACGTAGACGCATCCGACGTGTTGGCTCATGGAAAAGAAACGGAGGAGAACAGCTTCATCTACATTC
CTCCAAGAGGACGGAGCCAACAGTCTGACAAAAAAGTTCAGTGCTATGAACCTGCCACGATGAAGTATCTTGGATATTTC
CCTGCTCTCTCTACTTCCGAGGTTAAGGAGAGAGTGGCACTGTCAAGGAAGGCTCAGAAAACATGGGCTCAAAGTAGCTT
CAAGGTGAGAAGGCAGTTCTTGCGGATTCTTCTCAAGTACATTATCGAACACCAGGAGCTTATATGCGAAGTCTCGTCGC
GTGATACTGGAAAGACTATGGTTGATGCGTCCTTGGGCGAGATAATGACTACCTGTGAGAAAATCACTTGGCTTCTTTCG
GAGGGGGAACGATGGTTAAAGCCTGAATATAGGTCTTCAGGAAGAGCTATGCTTCATAAAGTATCAAGAGTAGAGTTCCA
TCCCCTTGGTGTCATTGGAGCTATAGTCCCATGGAATTATCCGTTCCACAATATCTTCAACCCTATGCTGGCTGCAGTCT
TCTCAGGGAATGGCATTGTTATTAAGGTTTCTGAACACGCTAGCTGGTCGGGATGCTTTTACTTCCGCATTATTCAAGCA
GCTTTAGCTGCCGTTGGAGCACCTGAAAATCTAGTCGATGTGATAACAGGGTTTGCGGAGACCGGAGAAGCGCTTGTCTC
ATCTGTTGATAAAATGATATTTGTTGGATCTACAGCTGTTGGCAAGATGATAATGAGAAATGCGGCTGAGACATTGACAC
CCGTCACTCTTGAGCTTGGTGGAAAAGATGCATTTATCATATGTGAAGATGCAGATGTCTCCCATGTTGCACAAGTGGCT
GTAAGGGGCACTCTTCAGTCCAGCGGGCAAAACTGTGCGGGTGCTGAAAGATTTTATGTTCACAAAGACATATATACTGC
ATTCATTACCCAAGTTACCAAGATTGTGAAGTCCGTTTCTGCTGGTCCTCCTCTAACTGGGAGGTACGACATGGGTGCTA
TATGTTTGCAAGAGCACTCTGAAACCCTACAGAGCCTAGTAAATGACGCCTTAGACAAAGGAGCAGAAATTGCCGTTCGC
GGAAGCTTTGGTCATCTTGGCGAGGATGCAGTCGATCAGTATTTCCCTCCAACTGTTCTTATCAATGTAAACCACACCAT
GAAGATAATGAAAGAAGAGGCCTTTGGACCAATAATGCCAATCATGCAATTCAGCACCGATGAAGAGGTCATAAAGCTGG
CGAATGATTCACGTTATGCGCTCGGCTGTGCCGTTTTTTCTGGAAGCCAGCGTCGAGCCAAACAAATTGCTTCTCAAATC
CAGTGCGGCGTCGCTGCAATCAATGACTTTGCATCAAACTACATGTGCCAGTCTCTCCCGTTTGGAGGTGTAAAGGATAG
CGGGTTTGGACGGTTTGCTGGCATAGAAGGTTTAAGAGCTTGCTGCCTTGTGAAATCCGTGGTCGAGGATAGGTTTTGGC
CACTCATCAAAACCAAGATTCCAAAACCTATTCAGTACCCGGTAGCAGAAAACGCATTTGAATTCCAGGAGGCACTAGTT
GAAACCCTCTATGGACTCAACATCTGGGACCGACTTAGATCCCTAATCGATGTCCTCAAGTTCCTTACCGATCAGAGCTC
TCACGTGAGCAGAACTAGAAAGAGCCACTAA