Details for Kale Locus Bo5g143200

Position : C5 ( 5`- 44272734 .. 44273011 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143200

Protein [Map View]
MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVKSGENATTED*

DNA
ATGGCCAAGTCGAAGAATCACACCGCGCATAACCAGTCGGCTAAGGCCCACAAGAACGGAATCAAGAAGCCCAGGAGGCA
CCGTCACACTCCCACCAGAGGAATGGACCCAAAGTTCTTGAGGAACCAGAGGTACGCTAGGAAGCACAACGTCAAGAGCG
GCGAGAATGCCACCACTGAAGACTAA